Proyectos de investigación financiados por fondos COVID-19

COV20_00070Ensayo clínico piloto, abierto, randomizado de uso combinado de Hidroxicloroquina, Azitromicina y Tocilizumab para el tratamiento de la infección por SARS-CoV-2 (COVID-19)Fundacio Privada Institut de Recerca de L´Hospital de la Santa Creu i Sant PaPere Domingo PedrolEl objetivo principal del estudio es evaluar la mortalidad intrahospitalaria,necesidad de ventilación mecánica, o necesidad de dosis de rescate de tocilizumab en los pacientes con infección confirmada por COVID-19 en tratamiento con hidroxicloroquina y azitromicina combinado con hocilizumab. El estudio comparará 2 ramas, terapia habitual en la práctica clínica, rama control; vs.tratamiento con tocilizumab, rama experimental.30/03/2020
COV20_00072Ensayo clínico aleatorizado multicentrico de terapia con plasma de convalecientes añadido al mejor tratamiento disponible para COVID-19 en pacientes hospitalizadosFUNDACION PARA LA INVESTIGACION BIOMEDICA DEL HOSPITAL UNIVERSITARIO PUERTA DE HIERROCristina Avendaño Solá y Rafael Duarte PalominoEl plasma hiperinmune de convalecientes (PC) se usa habitualmente en infecciones respiratoriass graves de causa vírica, en situación de urgencia y en base a estudios no comparativos de baja calidad. Ante la pandemia por SARS-CoV-2, proponemos realizar un ensayo randomizado en sujetos hospitalizados con formas no críticas de COVID-19 con PC vs "standard of care" (según guías WHO), en más de 20 hospitales, en coordinación con los centros de transfusión y el CNM-ISCIII, que nos permitirá analizar con alto nivel de evidencia la eficacia y la seguridad del tratamiento, incluyendo el riesgo de daño pulmonar mediado por anticuerpos y respuesta inmune, así como evaluar su impacto sobre la evolución de carga viral y la seroconversión (anticuerpos neutralizantes) de los pacientes, evaluar la factibilidad de un modelo de identificación de donantes y producción de PC para pacientes del SNS, y guiar en la toma de decisiones sobre PC en COVID-19 a nivel nacional e internacional.30/03/2020
COV20_00005Estudio piloto para evaluar la eficacia y seguridad de la mefloquina como profilaxis en personas expuestas a la enfermedad producida por coronavirus SARS-CoV-2 (COVID-19)Fundación para el Fomento de la Investigación Sanitaria y Biomédica de la Comunidad Valenciana (FISABIO)Félix Gutiérrez RoderoSe trata de un ensayo clinico multicéntrico randomizado doble-ciego de dos brazos comparando la eficacia y seguridad de la mefloquina frente a placebo en la profilaxis contra COVID-19 en contactos estrechos de personas infectadas. Así como estalecer si la administración preventiva de mefloquina atenúa las manifestaciones clínicas de la COVID-19 en las personas que se infectan, al tiempo que busca evaluar la seguridad de la mefloquina profiláctica en este escenario. Para ello, se van a seleccionar 200 contactos de personas en contacto estrecho con pacientes infectados por COVID-19 y que se van a asignar de manera aleatoria a uno u otro brazo del estudio y que deben seguir la pauta de administración señalada (un comprimido a la semana)06/04/2020
COV20_00023Ensayo clínico aleatorio para evaluar la eficacia de diferentes tratamiento en pacientes con COVID-19 que requieren hospitalizaciónFUNDACION PARA LA INVESTIGACIÓN BIOMEDICA DEL HOSPITAL UNIVERSITARIO LA PAZJosé Ramón ArribasExiste la necesidad urgente de evaluar mediante ensayos clínicos los fármacos actualmente en uso y con potencial de eficacia para COVID-19. Este protocolo evalúa la eficacia de diversos tratamiento en pacientes con neumonía grave por SARS-CoV-2. El diseño del estudio es un EC abierto, aleatorizado, que permite añadir/retirar brazos de tratamiento mientras el ensayo esta en curso de forma adaptativa a la información que se vaya generando en este estudio o en otros disponibles.06/04/2020
COV20_00096SEDACIÓN CON SEVOFLURANO EN PACIENTES CON SÍNDROME DE DISTRÉS RESPIRATORIO CAUSADO POR LA INFECCIÓN COVID19.FUNDACION PARA LA INVESTIGACION DE HOSPITAL CLINICO DE LA COMUNIDAD VALENCIANARAFAEL BADENES QUILESSe trata de un ensayo clínico randomizado, paralelo, no ciego, en las tres Unidades de Cuidados Intensivos (UCI) de nuestro Hospital. Los pacientes en sus primeras 24 horas de ingreso en UCC y tras diagnosticarles de SDRA, serán randomizados a recibir sevoflurano como sedante (grupoSEV) o sedación estándar con propofol (grupoPRO). El objetivo primario es la PaO2/FiO2 en el Día 2. Cómo objetivos secundarios están la mortalidad a los 30 días y los niveles de citoquinas (Factor de necrosis tumoral [TNF]alfa, IL-1beta, IL-6, IL-8) alveolares y plasmáticos en el momento de ingreso y en el Día 2. Los investigadores que realizarán los análisis serán ciegos a la asignación del grupo. Se trata de un análisis con intención de tratar 
COV20_00122Desarrollo de sensores colorimétricos basados en nanopartículas de oro para la detección del SARS-CoV2Fundación Instituto Madrileño de Estudios Avanzados en Nanociencia (IMDEA-Nanociencia)Rodolfo Miranda SorianoEl proyecto aborda la preparación de sensores colorimétricos basados en nanopartículas y oligonucleótidos, que permitan detectar la presencia del virus mediante un cambio en el color de una disolución, o la presencia de color en una tira de nitrocelulosa. El sistema se implementará a 3 sistemas distintos de amplificación con la finalidad de reducir el uso de equipos, personal altamente especializado y reactivos al mínimo: 1) en RT-PCR, evitando el uso de qRT-PCR, 2) en amplificación isotérmica, evitando el uso de PCR en general, y 3) en amplificación no-enzimática, evitando el uso de enzimas. Los procesos desarrollados son escalables industrialmente, y se espera adquirir rápidamente la capacidad en IMDEA Nanociencia de producir semanalmente 5.000 sensores basados en nanopartículas.06/04/2020
COV20_00399DEFIBROTIDE COMO PREVENCIÓN Y TRATAMIENTO DEL DISTRÉS RESPIRATORIO Y SÍNDROME DE LIBERACIÓN DE CITOQUINAS DEL COVID-19FUNDACION PARA LA FORMACION E INVESTIGACION SANITARIAS DE LA REGION DE MURCIA (FFIS)Jose M. Moraleda JiménezEl presente proyecto pretende demostrar que el DEF es eficaz y seguro como terapia para el COVID-19. El objetivo es disminuir la mortalidad en una tasa al menos del 25%. Se incluiran 120 pacientes con COVID-19 grados 4, 5 y 6 de la OMS, que se aleatorizarán 2:1 a recibir el tratamiento experimental o control respectivamente, y se estratificaran en función de la clasificación de la OMS en dos grupos:  40 pacientes grado 4-5 de la OMS, recibiran tratamiento experimental + tratatmiento estándar y 20 pacientes (grupo control) recibirán placebo más tratatmiento estandar, y 40 pacientes grado 6 de la OMS, recibiran tratatmiento experimental + tratamiento estándar, y 20 pacientes (grupo control) recibirán placebo más el tratamiento estándar.06/04/2020
COV20_00612Ensayo aleatorizado internacional para evaluar tratamientos no licenciados para COVID-19 en pacientes hospitalizados que reciben el tratamiento convencional para COVID que se ofrece en cada hospitalFundación para la Investigación Biomédica del Hospital Clínico San Carlos-IdISSC Vicente Estrada y Antonio PortolésEnsayo aleatorizado internacional de diseño adaptativo para evaluar tratamientos no licenciados para COVID-19 en pacientes hospitalizados que reciben el tratamiento convencional para COVID que se ofrece en cada hospital. Se incluirán Adultos>18a hospitalizados con COVID-19 confirmado por laboratorio sin contraindicación a los fármacos de estudio ni motivo para no participar. Se aleatorizarán a:TTo convencional o Tto convencional más uno de los fármacos ensayados (Remdesivir, Cloroquina/OHcloroquina, Lopinavir + Ritonavir o Lopinavir/Ritonavir + Interferón). A los pacientes incluidos se les sigue diariamente durante la duración del tratamiento. 06/04/2020
COV20_00050Desarrollo de una vacuna contra SARS-COV-2 mediante micro/nanoesferas de muNS-MiUNIVERSIDAD DE SANTIAGO DE COMPOSTELAJosé M. Martínez CostasHemos desarrollado y patentado una metodología que permite programar células de cualquier origen para que construyan micro (MS) o nanoesferas (NS) proteicas e introduzcan en ellas cualquier proteína de interés mediante su etiquetado con un tag denominado IC. Estas MS funcionan como vacunas en ausencia de adyuvantes y las proteínas integradas se pliegan perfectamente, permitiendo estructuras cuaternarias e incluso reacciones enzimáticas. En este proyecto pretendemos generar microesferas que contengan el dominio S1 de la proteína S o las proteínas M o N del SARS COV-2 y caracterizar en un modelo de ratón la respuesta inmune que inducen al administrar por vía intranasal o intramuscular. La metodología está ya desarrollada en los sistemas de expresión de baculovirus, células de mamífero y bacterias, y se adaptará al sistema de levaduras para su implementación rápida en vacunas humanas.08/04/2020
COV20_00279DETECCIÓN Y CARACTERIZACIÓN RÁPIDA DE COVID19 Y DEL PACIENTEFUNDACION PARA LA INVESTIGACION DE HOSPITAL CLINICO DE LA COMUNIDAD VALENCIANAFELIPE J. CHAVES MARTÍNEZEl ciclo biológico de los coronavirus permite la diferenciación entre el virus encapsulado y sus procesos de infección y replicación. Desarrollaremos kits modulares que permitan por un lado determinar la presencia del virus, la presencia de procesos víricos implicados en la infección y la determinación de aquellas variables que puedan ser relevantes en el desarrollo de la enfermedad (virales y humanas). Los kits se basaran en amplificación isoterma y mediante PCR rápida de las regiones de interés y su detección rápida (15-30 minutos la presencia del virus, disponible en 1 - 2 meses). En un segundo kit-módulo, a partir de estos amplificados y aquellos de interés en relación al paciente, se generaran librerías para ser secuenciadas mediante sistemas Nanopore. Esta segunda parte del estudio permitirá saber la cepa del virus y las variables del paciente que son relevantes en la enfermedad realizándose un informe en base a los datos disponibles e incluyendo otras variables clínicas de interés.08/04/2020
COV20_00286Efficacy of hydroxychloroquine in preventing infection and reducing viral load and disease severity in SARS-CoV-2 infected pregnant women in SpainFUNDACION PRIVADA INSTITUTO DE SALUD GLOBAL BARCELONA (ISGLOBAL)Clara Menéndez SantosIt is unclear how SARS-CoV-2 affects pregnant women and their offspring, as well as which factors may influence obstetrical disease and outcomes. This will be a randomized, double blinded, placebo-equivalent controlled multicentre trial aiming to assess the effect of hydroxychloroquine (HCQ) in reducing maternal viral load and the efficacy of HCQ to prevent incident SARS-CoV-2 infection. Pregnant women of any gestational age, parity and age, undergoing pre-natal follow up at four maternity hospitals with a positive PCR test, or who are contacts of a confirmed case, will be recruited and randomised 1:1 to receive HCQ orally (400 mg/day for 3 days, followed by 200 mg/day for 11 days) or ascorbic acid orally (500 mg for 3 days, then 250 mg/day for 11 days). Women will be followed up for the duration of the intervention when PCR tests for SARS-CoV-2 will be repeated, and up to delivery, when the pregnancy outcome will be registered, a cord blood sample and a neonatal throat swab will be collected after birth to be tested for SARS-CoV-208/04/2020
COV20_00080Prueba de concepto de detección rápida de superficies contaminadas por SARS-CoV-2 mediante análisis óptico y holográfico multiespectral con inteligencia artificialUNIVERSIDAD DE SEVILLAEmilio Gómez GonzálezEn la actualidad no existen métodos de detección y visualización de la presencia del virus SARS-CoV2 en superficies de materiales. Se propone el diseño, desarrollo y evaluación de un dispositivo prototipo (mediante tecnologías ópticas existentes combinadas con inteligencia artificial) portátil, para la detección rápida y sin contacto, in-situ, de zonas contaminadas en superficies. Se plantea i) combinar imágenes multiespectrales en el rango óptico (ultravioleta a infrarrojo térmico) y de terahercios, ii) usar métodos de análisis mediante óptica computacional, interferometría y holografía, iii) integrar la información mediante inteligencia artificial, y iv) realizar pruebas de laboratorio y en entornos contaminados y limpios.13/04/2020
COV20_00173Diagnóstico basado en nanosensores e identificación rápida en solución de disruptores de la interacción del virus SARS-Cov-2 con su receptor celular (NANOCOMPETE)FUNDACION PARA LA GESTION DE LA INVESTIGACION BIOMEDICA DE CADIZFrancisco García CózarExisten pocos ensayos serológicos frente al SARS-Cov-2 y ninguno que se pueda realizar en solución. El ensayo propuesto permite detectar anticuerpos (Ac) y/o virus desde suero o plasma, sin procesamiento e identificar directamente Acs que compitan la interacción virus/receptor (cuyos sueros podrán ser utilizados en sueroterapia). Utilizaremos muestras de los pacientes identificados para identificar secuencias codificantes de regiones variable de Acs con afinidad suficiente para bloquear la interacción virus/receptor y desarrollaremos CAR para la destrucción de células infectadas pero ta CAR reguladores para bloquear especificamente el sistema inmune, en aquellos casos en que es responsable de la patogenia de infecciones graves. Basandonos en desarrollos existentes, planteamos la prueba de concepto de un nanosensor, que permita el analisis de muestras por el público general y el envío de resultados medianteun smartphone13/04/2020
COV20_00505Diseño de antivirales para SARA basados en polifarmacologiaS0800099DBarcelona Supercomputing Center. CENTRO NACIONAL DE SUPERCOMPUTACIÓNVictor GuallarEs esencial diseñar antivirales capaces de inhibir, a la vez, diversos coronaviruses, introduciendo así una serie de moléculas que puedan actuar como primera línea de choque en mutaciones de SARS-CoV-2 y en las pandemia venideras. Para ello es imprescindible localizar dianas con alta similitud, bien caracterizadas estructuralmente, y realizar un cribado virtual de millones de compuestos, tarea que es solo posible con el uso masivo de supercomputación. Con este objetivo, hemos formado un equipo con amplia experiencia en desarrollo y aplicación masiva de software en estudios farmacológicos, así com en síntesis química y química medica. Los compuestos seleccionados y sintetizados se probarán en diferentes proyectos ya en marcha (a los que cederemos las moléculas): el consorcio Grifols-Irsicaixa y el centro nacional sincrotrón del reino unido, Diamond.13/04/2020
COV20_00820ESTUDIO DE LA PROTECCION DE BCG Y MTBVAC CONTRA SARS-Cov-2 EN PRIMATESUNIVERSIDAD DE ZARAGOZACarlos Martín MontañésEstudio de la actividad profiláctica de la inmunidad innata entrenada inducida por la vacuna viva atenuada MTBVAC comparada con BCG contra SARS-CoV2 en el modelo de macacos rhesus (Macaca mulatta) en el Biomedical Primate Research Centre (BPRC) de Holanda. La presente investigación se enmarca dentro de los estudios que el BPRC va a comenzar sobre la actividad de protección por el incremento de la inmunidad entrenada inducida por BCG contra SARS-CoV2 estudiando la inoculación de la vacuna BCG por diferentes vías de administración (intradermal, pulmonar e intravenosa) y que cofinancia la presente propuesta al 50%.13/04/2020
COV20_00144Transmisión de SARS-CoV2 por el aire: detección en hospitales y tecnologías innovadorasAGENCIA ESTATAL CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS, M.P.Antonio Alcamí PertejoNo existen actualmente metodologías eficaces para detectar virus en el aire. Nuestro grupo ha optimizado recientemente métodos basados en filtros capaces de retener la comunidad completa de virus en el aire. SARS-CoV2 es estable en el aire durante al menos 3h y es muy eficaz en la transmisión, pero su diseminación aérea no se ha estudiado. Proponemos utilizar esta metodología para detectar SARS-CoV2 en hospitales y realizar un estudio longitudinal de la prevalencia del virus en espacios hospitalarios. En paralelo, desarrollaremos nanopartículas como métodos colorimétricos de detección sencillos, aplicables a hospitales, para monitorizar rápidamente la presencia de virus captados en el aire. Desarrollaremos sensores laser-induced fluorescence (LIF) como un método de detección directa de partículas de SARS-CoV2 y otros virus en el aire, sin necesidad de procesar las muestras20/04/2020
COV20_00155DIAGNÓSTICO TEMPRANO DE COVID-19 MEDIANTE EL AISLAMIENTO DE EXOSOMAS EN INDIVIDUOS SOSPECHOSOS DE LA ENFERMEDAD.INSTITUTO ARAGONES DE CIENCIAS DE LA SALUDMARÍA DEL PILAR MARTÍN DUQUESARS-CoV-2 o Covid-19 es un nuevo tipo de coronavirus que produce una infección respiratoria grave. Siguiendo las indicaciones de la OMS, se ha anunciado que en breve se emplearán nuevos test diagnósticos, mucho más rápidos, pero también más imprecisos que podrán dar falsos positivos y negativos. Además, durante los primeros momentos de la infección, algunos pacientes resultaron negativos inicialmente, pese a estar infectados, con la subsecuente transmisión de la infección. Dado que se ha encontrado material genético de coronavirus en exosomas de suero y del HIV-1 en exosomas de orina de personas infectadas aquí sugerimos realizar, los test diagnósticos sobre los exosomas de orina, plasma y saliva de pacientes a diversos tiempos del estudio, para detectarlo de manera mas fiable y temprana.20/04/2020
COV20_01036SARS-COV-2 diagnosis by phi29 polymerase amplificationFUNDACIÓN DEL SECTOR PÚBLICO ESTATAL CENTRO NACIONAL DE INVESTIGACIONES ONCOLÓGICAS CARLOS IIIFelipe Cortés Ledesma / Luis Blanco DávilaThe project aims the validation of a reliable method for diagnosis of SARS-COV-2 infection. This novel method will allow the improved detection of the viral RNA molecule by means of a virus-specific linear probe that becomes circularized only in the presence of the viral RNA. Once the probe becomes circular, an engineered form of phi29 DNA polymerase (CSIC patent licensed to 4basebio) will start copying the circular template by generating an unlimited synthesis reaction defined as "rolling-circle replication" (RCR), which depends on the unique and robust strand-displacement synthesis capacity of this phi29 DNA polymerase variant. This peculiar mode of synthesis, a hallmark of the isothermal DNA amplification of full genomes used worldwide, could be easily detected as a readout of the presence of SARS-COV-2 genomic RNA20/04/2020
COV20_00624Diseño de balizas moleculares para la identificación rápida y eficaz de especies de ARN de SARS-CoV-2 en muestras de pacientes de COVID-19AGENCIA ESTATAL CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS, M.P. Mario Fernández Fraga / Juan Ramón Tejedor VaqueroDebido a la emergencia sanitaria causada por la irrupción de la pandemia de COVID-19, y ante un posible escenario de repunte o cronicidad de la enfermedad, urge el desarrollo de herramientas que faciliten la detección y el seguimiento de los pacientes susceptibles a infección por el virus SARS-CoV-2. Este proyecto pretende generar un test alternativo, rápido y sensible para la detección directa de especies de ARN del virus a partir de muestras humanas, con el fin de simplificar los tiempos, los costes y la complejidad experimental que se requieren para el diagnóstico actual de COVID-19. Para ello, esta propuesta contempla el diseño de una batería de balizas moleculares fluorescentes y el empleo de análisis fluorimétricos escalables mediante el empleo de la tecnología de amplificación de señal por enzima melladora (del inglés, NESA), con el fin de realizar una identificación directa, efectiva y a bajo coste de diferentes especies de ARN del coronavirus en muestras humanas.27/04/2020
COV20_00823Rapid serological testing for combined detection of IgG and IgM against SARS-CoV-2UNIVERSITAT ROVIRA I VIRGILICiara O'SullivanThe project aims at the development of a rapid and easy-to-use serological test for the screening of COVID-19 and the differentiation between current and past infections. The addition of fingerprick blood sample and a final immersion of dipstick/addition of substrate is the only required end-user intervention. It is based on the detection of the IgM and IgG antibodies produced by infected person's immune system to fight the infection. The assay design will diffe from the common format used by numerous manufacturers to eliminate the possibility of false negative results. Gold and carbon nanoparticle labels will be used for visual readout and the specific colour combination on the strips will be related to the presence of specific antibody type. A recombinant COVID-19 antigen will be prepared for the final preparation of prototype tests to be validated using patient blood samples. The assay time will be less than 15 minutes and the production cost will be ca 1€27/04/2020
COV20_00565Prevención de infección por COVID19 mediante administración de hidroxicloroquina en mayores institucionalizados y personal asistencial de residencias. Ensayo clínico controlado, abierto y aleatorizado escalonado (stepped-wedge) por clustersFUNDACION PARA LA INVESTIGACION DE MALAGA EN BIOMEDICINA Y SALUD (FIMABIS)JOSÉ MIGUEL MORALES ASENCIOObjetivo: Evaluar la efectividad de quimioprofilaxis con hidroxicloroquina a personal asistencial y residentes: a) sobre la incidencia de casos secundarios de infección SARS-CoV-2 en residentes, y b) sobre la incidencia de infección por SARS-CoV-2 en el propio personal. Evaluar el efecto de medidas de promoción del control de la infección. Diseño: Estudio controlado, aleatorizado, abierto por clusters escalonado. Sujetos: mayores institucionalizados y profesionales de atención directa en 4 CCAA . Muestra: 880 profesionales, 1050 residentes en 84 residencias. Se les administrará 800mg de HCQ el primer día y 400 mg durante cuatro días. Se tomará exudado nasofaríngeo para RT-PCR basal, 6 y 14 días y serología basal y 28 días. Se evaluarán secundariamente mortalidad, cumplimiento, seguridad, síntomas, ingreso y carga viral.29/04/2020
COV20_00021REGISTRO EPIDEMIOLOGICO DE EMBARAZADAS CON COVID 19FUNDACION INVESTIGACION BIOMEDICA HOSPITAL PUERTA DE HIERROOSCAR MARTINEZ PEREZEstudio epidemiologico multicentrico español basado en el registro de casos de gestantes con COVID 19 en España Objetivo el conocimiento de la influencia del COVID 19 en las gestaciones y parto en nuestro pais. 77 Centros asociados en el momento de elaborar este documento. Base de datos que cumple ley de protección de datos Se trata de un estudio registro prospectivo observacional de gestantes en las que se sospeche que tiene una infección por SARS-CoV-2 en cualquier momento durante el embarazo con resultados de prueba positivos para SARS-CoV-2. Seguimiento hasta dos semanas del parto. Fecha de inicio Marzo 2020.Final Marzo 2021 Se piden 43 000 € para crear una base de datos propia , explotarla y comunicar los resultados30/04/2020
COV20_00027Uso de fármacos que incrementan la expresión de ACE2 y riesgo de COVID-19: Un estudio caso-población.FUNDACION INVESTIGACION BIOMEDICA HOSP. PRINCIPE DE ASTURIAS Francisco José de Abajo Iglesias El SARS-CoV-2 utiliza la enzima convertidora de angiotensina 2 (ACE2) para penetrar en las células y replicarse. Se conoce que ciertos fármacos aumentan la expresión de la ACE2 y pudieran facilitar la entrada del virus y fomentar la gravedad de la infección. Se pretende realizar un estudio epidemiológico de casos y controles, tomando como casos los pacientes hospitalizados por COVID-19 en los hospitales participantes (subclasificados por gravedad) y controles poblacionales de atención primaria extraidos de la base de datos BIFAP y apareados con los casos por edad (exacta), sexo y fecha indice. De las historias clinicas hospitalarias y de Bofap se extraerá información de los fármacos prescritos sy comorbilidades y se computará el Odds Ratio ajustado mediente modelos de regresión logística condicionada. Se valorará extraer información de casos COVID-19+ leves no hospitalizados como serie alternativa de controles (razon 1:1)30/04/2020
COV20_00040Efecto a corto, mediano y largo plazo de la enfermedad por Coronavirus 2019 en el sitema cardiovascular.INSTITUTO DE INVESTIGACIONES BIOMEDICAS AUGUST PI I SUNYER (IDIBAPS)Salvatore BrugalettaLos pacientes que presentan enfermedad COVID-19 tienen un muy alto riesgo de eventos adversos cardiovasculares a corto y largo plazo, incluyendo la muerte por causas cardiovasculares. Proponemos un estudio de vigilancia epidemiológica para determinar la tasa de eventos cardiovasculares adversos (mierte cardiovascular, infarto de miocardii, accidente cardiovascular, arritmias cardiacas= en  el momento de la infección, 30 días, 6 y 12 meses, en los pacientes confirmados por COVID-19. Además, determinar la relación entre el uso de fármacos inhibidores de la enzima convertidora de angiotesina 2, bloqueadores del receptor de angiotesina 2 y antiinflamatorios no esteroideos en la presentación de cuadros graves o fatales por COVID-19. mediante estudio de casos y controles. Desarrollaremos herramientas de alarma precoz, predicción y estratificación de riesgo de eventos adversos cardiovasculares en los pacientes con COVID-19. A través de una página web se hará difusion inmediata de la información generada y uso abierto de las herramientas desarrolladas.30/04/2020
COV20_00108Infección por COVID-19 en pacientes infectados por VIH incluidos en CoRISFUNDACION INVESTIGACION BIOMEDICA HOSPITAL GREGORIO MARAÑONJuan BerenguerHasta la fecha solo se han descrito casos anecdóticos de COVID-19 en personas infectadas por VIH. Esto permite sostener la hipótesis de que quizá los fármacos antirretrovirales pudieran tener algún efecto protector frente a la infección por SARS-CoV-2. Para tener información fiable acerca de la incidencia de infección sintomática o asintomática por SARS-CoV-2 pretendemos llevar a cabo un estudio retrospectivo en el ámbito de la Cohorte de la Red de Investigación en Sida de España (CoRIS). Objetivos: (i) describir la frecuencia y características epidemiológicas y clínicas de los pacientes con COVID-19 en CoRIS, así como los factores pronósticos de requerimiento de cuidados intensivos, utilización de ventilación mecánica, duración de ingreso y de mortalidad; y (ii) Estudiar la prevalencia de anticuerpos frente a SARS-CoV-2 mediante la determinación de anticuerpos IgG e IgM mediante ELISA30/04/2020
COV20_00110Factores de riesgo, pronóstico personalizados y seguimiento a un año de los enfermos ingresados en las unidades de Ciudadanos Intensivos Españolas infectados por el virus COVID:CIBERSESUCICOVIDCONSORCIO CENTRO DE INVESTIGACION BIOMEDICA EN RED (CIBER) Antoni Torre MartíEl proyecto que se presenta tiene el objetivo de conocer los factores de riesto y pronóstico y desenlaces a corto y largo plazo (6 meses y un año) de los pacientes con COVID19 ingresados en las UCI's Españolas. Otros dos objetivos adicionales son el estudio epigenético y biomarcadores esenciales de enriquecimiento predictivo para ayudar a individualizar el tratamiento en base a las vias biológicas alteradas en cada paciente. CIBERES cuenta con el aval de SEMICYUC y SEPAR. La hipótesis al final de la pandemia que habrán ingresado 10000 pacientes en las UCI's españolas seleccionadas a través de SEPAR Y SEMICYUC. Los datos clínicos se analizarán con inteligencia artificial, Se hará un análisis interino con los 1000 primeros pacientes lo que puede ser de utilidad para el manejo clínico de los pacientes con COVID19 graves.30/04/2020
COV20_00156ANALISIS NGS DEL BROTE DE SARS-COV2 DEL HOSPITAL GENERAL DE ELCHEFUNDACION PARA EL FOMENTO DE LA INV. SANITARIA Y BIOMEDICA DE LA COMUNIDAD VALENCIANA (FISABIO)Antonio Galiana CabreraEstudio molecular empleando la técnica NGS para la obtención de ls secuencias del genoma del virus SARS-Con2 de los casos positivos identificados en el departamento 20 de salud de la Comunidad Valenciana. Con los datos obtenido se podrá realizar un análisis epidemiológico molecular de la variación genética del virus en este departamento desde el inicio del brote hasta la finalización del mismo. Además estas secuencias contribuirán a incrementar las secuencias genómicas de este virus en las bases de datos mundiales que permitirán la realización de estudios epidemiológicos tanto a nivel nacional como mundial. Con la información que se genere se podrá poner en contexto con los datos clínicos de los pacientes afectados por la infección del SARS-CoV-2 y se podrán identificar si existe alguna relación o algún clúster del virus con más prevalencia o peor pronóstico en nuestro departamento de salud.30/04/2020
COV20_00157Afectación neurológica en la enfermedad Covid-19 clinicamente relevante. ¿existe la enfermedad Neuro-Covid-19?FUNDACION PARA LA INVESTIGACION DE MALAGA EN BIOMEDICINA Y SALUD (FIMABIS)Pedro Jesus Serrano Castro /  Fernando Rodriguez de FonsecaEl coronavirus SARS-COV-2, de forma similar a los que ocurre con otros virus de la misma familia, tiene capacidad para afectar al sistema nervioso. A esta capacidad neuroinvasiva se le ha atribuido un potencial valor pronóstico por estar relacionada con el fallo respiratorio en los pacientes infectados [1]. Por otro lado, en una revisión retrospectiva sobre 214 casos asistidos durante el brote epidémico en Wuhan, se describen síntomas atribuibles tanto al SNC como al SNP en un porcentaje relevante (Mao L et al MedRxiv 2020.02.22.20026500). En base a estos datos, establecemos la hipótesis de que la afectación neurológica en fase aguda y a medio o largo plazo puede condicionar el pronóstico y la de calidad de vida en pacientes supervivientes a la infección. El objetivo de este proyecto es la caracterización clinica, biológica y molecular de la afectación neurológica en una cohorte prospectiva de pacientes supervivientes a infección por SARS-CoV-2.30/04/2020
COV20_00170Búsqueda de marcadores inmunológicos, pronóstico y terapéuticos en pacientes con COVID-19FUNDACION INSTITUTO DE INVESTIGACION MARQUES DE VALDECILLA (IDIVAL)Marcos López HoyosNuestro objetivo primario es el estudio de la respuesta inmunitaria innata y adquirida en los pacientes diagnosticados de SARS-CoV-2, mediante la monitorización de los componentes celulares y humorales de la respuesta inmunitaria innata y adaptativa en sangre y su correlación con la gravedad clínica. Este panel es semejante al empleado en la caracterización clínica de pacientes inmunodeprimidos y de aplicación inmediata al manejo del paciente con COVID-19.30/04/2020
COV20_00181STOP-Coronavirus: factores clínicos, inmunológicos, genómicos, virológicos y bioéticos de COVID-19FUNDACION INVESTIGACION BIOMEDICA HOSPITAL 12 DE OCTUBREJosé María Aguado GarcíaSTOP-Coronavirus consta de ocho paquetes de trabajo (work packages [WPs]) a lo largo de 12 meses: WP0 (transversal): constitución de un cohorte prospectiva de pacientes con COVID-19, caracterización clínica y recogida de muestras biológicas (HU12O, HUFJD/IIS-FJD, HCUVA, HUIE); WP1 (clínico): modelo predictivo basado en variables clínicas y bioquímicas (HU12O); WP2 (inmunológico): respuesta inmune a SARS-CoV-2 (HU12O, HCUVA); WP3 (genómico): marcadores pronósticos genéticos del huésped (HUFJD/IIS-FJD, HCUVA); WP4 (inmunodeprimidos): COVID-19 en pacientes oncohematológicos y trasplantados (HU12O, HUFJD, HCUVA); WP5 (terapéutico): respuesta al tratamiento antiviral e inmunomodulador (HU12O); WP6 (bioético): análisis socio-económico y repercusiones éticas (HUIE, HUFJD, HCUVA); y WP7 (virológico): dinámica viral y espectro de mutantes de SARS-CoV-2.30/04/2020
COV20_00188Gestación y COVID-19: estudio clínico y microbiológico (GESTA-COVID19)FUNDACION INSTITUTO DE INVESTIGACION VALLE DE HEBRONAnna Suy FranchObjetivo: El objetivo principal de este estudio es describir la influencia del embarazo sobre la infección COVID-19, así como la influencia del COVID-19 (y su tratamiento) sobre el embarazo, el feto y el recién nacido.
Métodos: Se trata de un estudio descriptivo, observacional longitudinal y multicéntrico formado por 8 hospitales: H. U. Vall d'Hebron (Barcelona) y H.U. La Paz (Madrid), H.U. Virgen de la Arrixaca (Murcia), H.U. Cruces (Bizkaia) y H.U.C. Lozano Blesa (Zaragoza), Hospital Universitario San Cecilio (Granada), H.U. La Fe (Valencia), H.U. Torrejón (Madrid). Se  llevará a cabo entre abril 2020 y marzo 2021. Se diseñará un cuaderno de recogida de datos electrónico (REDCap) donde se introducirá los datos de forma anónima. Se incluirán gestantes infectadas por SARS-CoV-2, se recogerán y procesarán (PCR-SARS-CoV-2 de forma diferida) muestras microbiológicas de la madre y en recién nacido y datos clínicos relacionados con la paciente, la infección su tratamiento y complicaciones, el embarazo y complicaciones, el parto y el recién nacido. Los resultados se divulgarán a la comunidad científica, la sociedad y las autoridades sanitarias.
COV20_00227INFECCIÓN POR EL SARS-CoV-2 EN LOS PACIENTES CON ENFERMEDAD INFLAMATORIAFUNDACIÓ DOCÈNCIA I RECERCA - MÚTUA TERRASSAMaria Esteve y Yamile ZabanaObjetivo:Evaluar: 1) la incidencia, forma de presentación clínica, gravedad y mortalidad de CoVid19 en el periodo epidémico (5 meses). 2) la evolución de los pacientes bajo tratamiento inmunosupresor y/o biológico en comparación con los que no lo reciben 3) Factores clinicos, demográficos, epidémiológicos asociados al riesto de contraer la infección y de presentar mala evolución 4) influencia de la infección por COVID-19 en la evolución de la Eli y su tratamiento al año de la infección.30/04/2020
COV20_00236Estudio del Microbioma y Viroma asociados a la enfermedad CoVid19FUNDACION DE LA COMUNIDAD VALENCIANA PARA LA GESTION DEL INST. INV. SANIT. Y BIOMEDICA DE ALICANTEJuan Carlos Rodríguez DíazLa infección por este virus cursa desde formas asintomáticas hasta neumonías bilaterales muy graves que originan frecuentemente la muerte del paciente. El microbioma y el viroma están alterados en un gran número de patologías, pero se desconoce su implicación en este proceso aunque es posible que ambos estén implicados en la diferente gravedad clínica del paciente. Por lo tanto, se plantea realizar el estudio del microbioma y del viroma mediante un análisis bioinformático y estadístico de la diversidad microbiana y de los taxones presentes en cada una de las muestras, para poder identificar biomarcadores de gravedad del proceso que puedan ser utilizados en el mejor manejo del paciente.30/04/2020
COV20_00310Seguimiento ecográfico en gestantes con infección por COVID-19. Riesgos asociados a la infección severa y al trimestre del embarazo.INSTITUTO DE INVESTIGACIONES BIOMEDICAS AUGUST PI I SUNYER (IDIBAPS)Marta López RojanoLas implicaciones de la pandemia por COVID-19 sobre la gestación no son bien conocidas, La infección materna severa puede asociarse a parto prematuro o retraso de crecimiento fetal. La hipoxia materna podría tener consecuencias sobre el neurodesarollo y a nivel cardiaco fetal. Por otro lado, no existen datos sobre las repercusiones de la infección por COVID-19 según el trimestre de la gestación. Nuestro objetivo es analizar el resultado perinatal y el riesgo de retraso  crecimiento, anomalías a nivel de neurosonografía o ecocardiografía   fetal en mujeres con COCID-19, así como los factores asociados (infección materna severa, hipoxemia, edad gestacional a la infección). Los resultados esperados pueden ser de gran utilidad para asesorar sobre los eventuales riesgos fetales, mejorando la asistencia y la experiencia del embarazo.30/04/2020
COV20_00314Inmunosenescencia como factor de riesgo para la infección por SARS-CoV-2ASOCIACION INSTITUTO BIODONOSTIADavid Otaegui / Alvaro PradaEn este proyecto pretendemos hacer una aproximación rápida al estado de las poblaciones linfocitarias y del proceso de inflamación en pacientes COVID19 positivo con y sin síntomas frente a pacientes COVID19 negativo. Con la hipótesis de que la inmunosenescencia está jugando un papel en la susceptibilidad a ser infectado, los estudios se realizarán en diferentes rangos etarios (30-40 / 40-50 /50-60 / mayores de 60). En el caso de los pacientes COVID19 positivo Los perfiles de inmunosenescencia e inflamación en el momento del diagnóstico se correlacionarán con las variables clínicas de monitorización de la enfermedad en busca de marcadores pronóstico de la evolución30/04/2020
COV20_00324Functional characterization of SARS-CoV-2-specific T and B cell long-lasting Immunity in immunocompetent and immunosuppressed patients developing SARS-CoV-2 infection (COV-Immunity)FUNDACIÓN INSTITUTO DE INVESTIGACIÓN BIOMEDICA DE BELLVITGE (FUNDACION IDIBELL) Oriol Bestard MatamorosIn this project we will investigate, using highly sensitive immune assays, the development of short and long-lasting immunity, both humoral and cellular, specific against SARS-cOv-2, at the time of infection and at different time points afterwards up to 24 months in previously healthy individuals, patients with relevant co-morbidities, solid organ transplant patients receiving chronic immunosuppression and patients with malignancies receiving chemotherapy.30/04/2020
COV20_00377Papel de las células NK en la susceptibilidad y el pronóstico de la infección por SARS-CoV2 (COVID19)FUNDACION PARA LA FORMACION E INVESTIGACION SANITARIAS DE LA REGION DE MURCIA (FFIS)ENRIQUE BERNAL MORELLEl proyecto investiga el papel de las células NK en la susceptibilidad y el pronóstico de la infección por SARS-CoV2 (COVID19). En pacientes con enfermedad leve (n=100) y grave (n=100) se analizará el genotipo (PCR-SSO-Luminex) y la expresión en células NK (citometría 12 Fluorescencias) de las interacciones KIR/ligandos-HLA-I que regulan la educación y función de estas células y determina su efectividad frente a infecciones virales. Los datos se contrastarán con 600 controles sanos de genotipo conocido. Los resultados contribuirían a optimizar los recursos sanitarios y evitar el colapso al facilitar: 1) acentuar los esfuerzos de protección en personas más susceptible (profesionales sanitarios, fuerzas del orden, familiares de enfermos,etc); y 2) anticipar terapias anti-virales y anti-inflamatorias a la aparición de la sintomatología más grave en enfermos susceptibles.30/04/2020
COV20_00385Derivación y validación de una escala pronóstica en neumonía por COVID-19. Estudio multicéntrico nacionalFUNDACION PARA LA INVESTIGACION DEL HOSPITAL LA FEROSARIO MENÉNDEZ VILLANUEVALa enfermedad por COVID-2019 supone un desafío para ka capacidad de los sistemas nacionales de salud. El curso de la enfermedad difiere de otras neumonías conocidas hasta la fecha. El objetivo principal es derivar y validad un score pronóstico (COVID-19) Severity Index [CSI] a partir de una base de datos multicéntrica en pacientes con neumonía por COVID-19 con variables pronósticas de gravedad al ingreso para predecir requerimiento de UCI y muerte. Se realizará un estudio, retrospectivo y multicéntrico de pacientes adultos con neumonía por COVID-19 que requieran hospitalización en hospitales de toda la geografía española (se estima reclutar unas 4.000 neumonías).30/04/2020
COV20_00386Impacto de la linfocitosis B monoclonal y del estado del sistema inmune en el desarrollo y evolución de la infección COVID-19 en adultosFUNDACION INSTITUTO DE ESTUDIOS DE CIENCIAS DE LA SALUD DE CASTILLA Y LEONJosé Alberto Orfao de Matos Correia e ValeEn este proyecto partimos de la hipótesis de que los pacientes infectados por el virus SARS-CoV-2 portadores de un sistema inmune envejecido -determinado por la presencia de pequeños clones de células B circulantes en sangre periférica y la inmunodeficiencia secundaria asociada a esta condición-, desarrollarían una enfermedad más grave y evolucionarían peor por su incapacidad de reconocer nuevos antígenos. Para ello, proponemos: 1) explorar la presencia de clones linfoides B (LBMlo) en la sangre de pacientes infectados ingresados en el S. de Medicina Interna del Hospital Universitario de Salamanca; 2) estudiar el estado de su sistema inmune, mediante herramientas innovadoras desarrolladas por el grupo de investigación que permiten identificar en sangre >250 poblaciones distintas de células inmunes; 3) relacionar los datos anteriores con las características clínicas de los pacientes; e 4) identificar parámetros relacionados con un sistema inmune envejecido que proporcionarán una base sólida para una estratificación pronóstica, y validación clínica. 30/04/2020
COV20_00004Estudio clínico-epidemiológico de la enfermedad por coronavirus (COVID-19) en centros sociosanitarios: estudio COVID-AServicio de Salud de Castilla-La Mancha (SESCAM)Pedro Abizanda SolerEl objetivo es realizar un estudio clínico-epidemiológico lo más amplio posible en las residencias de mayores de Albacete provincia para analizar sus características clínicas, sociodemográficas, funcionales, cognitivas, nutricionales y de síndromes geriáticos, identificar factores predisponentes a la infección y los resultados de salud específicos en esta población de altísimo riesgo. Inicialmente se realizará en las residencias de mayores “Vasco Núñez de Balboa”, “Paseo de La Cuba”, “Vital Parque”, “Alcabala” y “Alábega” aunque podría ser ampliable a otras residencias. En total se prevé incluir alrededor de 1000 residentes. Se realizará un seguimiento a los 3 y 6 meses para recoger variables de resultado clínicas, epidemiológicas y económicas en colaboración con el Departamento de análisis económico de la UCLM (Toledo). El estudio lo realizará en Servicio de Geriatría de Albacete.01/05/2020
COV20_00047Reposicionamiento terapéutico dirigido a inhibición de expresión de ACE2 y de proteolisis de trímero S viralINSTITUTO INV. BIOMEDICA DE LLEIDA. FUNDACION DR. PIFARRE (IRBLLEIDA)Manuel Portero-OtinDiversas lineas celulares (e.g. Vero o Calu-3) expresan en su membrana celular la proteína ACE2, participante en la unión con el trimero S de SARS-Cov-2, y tambien presenta actividades proteolíticas para la activación de la misma proteina, dos de los hipotéticos requisitos para la entrada del virus en huésped humano. Según ella, aquellas sustancias que puedan disminuir el rol de ACE2 o la actividad de proteasas del huesped sobre proteína S, pdrían utilizarse para el tratamiento de la infacción. Así se emplearán como moléculas condidatas i) librerías comerciales de fármacos autorizados para el uso en humanos y ii) oligonucleótidos antisentido con vahiculos peptídicos como nueva aproximación terapéutica.01/05/2020
COV20_00086PsyCorona: a multinational initiative of urgent data collection with a longitudinal and prospective approachUNIVERSIDAD DE CÓRDOBAMANUEL MOYANO PACHECOWe are conducting a rapid, multi-national collaboration that aims to identify psychological and cultural factors that may be relevant to the virus spread and its imminent social and material consequences. The online survey includes brief measures to assess topic-relevant beliefs, fears, hopes, and frustrations, predictors of self-containment and social distancing, attitudes toward policies, reasoning, and behavioral self-reports. The survey has a built-in longitudinal component as well as a broader data science mission involving metadata. This is an unfunded, citizen-scientist initiative comprised of 40+ colleagues (and counting). The goal of of group is to publish reports suggesting to policy makers the most promising avenues to thwart the spread of the virus.01/05/2020
COV20_00086PsyCorona: a multinational initiative of urgent data collection with a longitudinal and prospective approachUNIVERSIDAD DE CORDOBAManuel Moyano PachecoWe are conducting a rapid, multi-national collaboration that aims to identify psychological and cultural factors that may be relevant to the virus spread and its imminent social and material consequences. The online survey includes brief measures to assess topic-relevant beliefs, fears, hopes, and frustrations, predictors of self-containment and social distancing, attitudes toward policies, reasoning, and behavioral self-reports. The survey has a built-in longitudinal component as well as a broader data
science mission involving metadata. This is an unfunded, citizen-scientist initiative comprised of 40+ colleagues (and counting). The goal of of group is to publish reports suggesting to policy makers the most promising avenues to thwart the spread of the virus. 
COV20_00121Identificación del perfil transcripómico dinámico en pacientes con COVID-19 y síndrome de distrés respiratorio agudo (TRANSCOVID)FUNDACIÓN INSTITUTO DE INVESTIGACIÓN BIOMEDICA DE BELLVITGE (FUNDACION IDIBELL) Jordi Carratalà FernándezAunque se han descrito algunas características clínicas (edad avanzada, fiebre elevada, SOFA) y de respuesta inflamatoria (IL-6, PC-R, dímero-D), las razones por las que determinados pacientes con COVID-19 desarrollan una enfermedad grave, presentando disnea e hipoxemia en los primeros 7 días y rápida progresión a SDRA, fracaso multiorgánico y muerte, continúan siendo todavía un enigma. El objetivo principal del presente proyecto es determinar el perfil transcriptómico dinámico de pacientes adultos hospitalizados por COVID-19 y caracterizar el subgrupo que desarrolla una enfermedad grave (SDRA). Como objetivos secundarios se pretende establecer una signatura de genes capaz de discriminar basalmente el grupo que desarrollará SDRA y contribuir a la filogenia del virus.01/05/2020
COV20_00140Addressing unknowns of COVID-19 transmission and infection combining pathogen genomics and epidemiology to inform public health interventionsAGENCIA ESTATAL CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS, M.P.Iñaki Comas EspadasThere is a growing pressure to understand the transmission patterns of COVID-19. As a new, emergent virus we have important gaps in the epidemiology of its infection. Those gaps translate also to limited understanding on who is infectious and for how long and how is connected to clinical outcome. Here we propose several objectives that involve combining viral genome data to epidemiological, clinical information to address those gaps. We will obtain viral complete genome sequences and epidemiological data and combine to (1) inform public health measures by revealing highways of transmission; (2) identify when an individual is infectious; (3) identify early warnings of local spread; (4) viral diversity connected to immune, drug and diagnostic; (5) complement current diagnostic approaches, and (6) identify the connection to adverse clinical outcomes. To this end, we have put together a nation-wide group of infectious disease, genomics, bioinformaticians and clinical researchers from more than 30 institutions.01/05/2020
COV20_00151Desarrollo de una vacuna, MVA-COVID-19, expresando antígenos del SARS-CoV-2AGENCIA ESTATAL CONSEJO SUPERIOR DE INVESTIGACIONES CIENTÍFICAS M.P.Juan García ArriazaOur objective is to produce an effective vaccine against SARS-CoV-2 as follows:
Vaccine 1: This vaccine named MVA-COVID-19(S) will express the full-length S protein of
SARS-CoV-2 and is directed to generate in an organism neutralizing antibodies to prevent infection and virus spread. This vaccine is ongoing in our laboratory and expected to have the candidate during April-May 2020 to be used for preclinical studies during June-July 2020.
Vaccine 2: This vaccine named MVA-COVID-19(S-E-M) will express three proteins of SARSCoV-2 (S, E and M) in the form of VLPs and is directed to trigger neutralizing antibodies and T cell (CD4+ and CD8+) immune responses, with the goal to produce long-term control of virus infection. This vaccine will be generated along May-September 2020 to initiate the preclinical studies in October-December 2020.
COV20_00183Una terapia innovadora contra el Covid-19 basada en ARN circularesUniversidad Pompeu FabraJUANA DÍEZ ANTÓNDada la rapidez con que podemos secuenciar los genomas de nuevos virus ARN, desarrollar terapias dirigidas contra éstos, en vez de contra las proteínas virales, aceleraría el desarrollo de terapias eficientes. En este proyecto generaremos y validaremos, en cultivo celular y en modelos de ratón, ARN circulares (ARNcircs) que hibridan e interfieren estructuras esenciales en el genoma del SARS-CoV-2 y lo inactivan. La selección de resistencias es altamente improbable dada la conservación de las secuencias diana y la interferencia sobre varias regiones simultáneamente. Nuestro éxito anterior con ARNcircs que inhiben la replicación de otros virus ARN(+), y la existencia de terapias basadas en ARN ya en clínica y de sistemas de administración por nebulización, apoyan la viabilidad de nuestra propuesta.01/05/2020
COV20_00214Preclinical development of innovative mRNA/MVAvaccines against SARS-CoV2INSTITUTO DE INVESTIGACIONES BIOMEDICAS AUGUST PI I SUNYER (IDIBAPS)Felipe GarcíaThe purpose of this project is to design and test in preclinical studies a new vaccine against SARS-CoV2.The overall objective:
1. In a first step, to test a new mRNA vaccine candidate encoding SARS-CoV2epitopes selected through a bioinformatic approach and co-formulated with nanoparticles (mRNA-CoV2) in vitro and in vivo to assess the potential to induce SARS-CoV2-specific immune responses.
2. In a second step, to test if a prime-boost strategy with mRNA-CoV2 prime and MVA-CoV2 boost induce higher immune responses as compared with mRNA-CoV2 alone.
COV20_00237Platarformas de desarrollo de vacunas bioseguras contra SARS-CoV-2FUNDACION MIGUEL SERVET-NAVARRABIOMEDDavid Escors MurugarrenSe establecerá una plataforma de ingeniería de vacunas bioseguras contra SARS-CoV-2, que incluye tres procedimientos de producción. El primero utilizará células humanas secretoras de partículas semejantes a virus (virus-like particle, VLPs), mediante la expresión constitutiva de las proteínas S, M y E de SARS-CoV-2. El segundo utilizará vectores baculovirales para la expresión de estos genes a gran escala y comparar la producción de VLPs. El tercero se basará en la producción de partículas lentivirales no replicativas y no integrativas, pseudotipadas con la proteína S de SARS-CoV-2 y expresando el resto de proteínas estructurales. Estas partículas proporcionarán los epítopos B y T al sistema inmunitario en un formato VLP. Se incorporará BIRB796 a las preparaciones vacunales para potenciar la respuesta T humana, dado que es un inhibidor de MAPK p38 aprobado para uso humano y con propiedades anti-senescentes en linfocitos.01/05/2020
COV20_00297An Efficient Peptide Vector for mRNA Vaccination Against COVID19Universidad de Santiago de CompostelaJavier Montenegro GarcíaIn the race to find a COVID-19 vaccine, gene-based approaches are the leading choice with some already ongoing clinical trials. However, the major challenge of this technology is the extreme sensitivity and the very low cellular uptake of the gene material that triggers the hosts' immune response, which hampers their potential. To overcome this limitation, we have developed a synthetic platform for the rapid screening of peptide amphiphiles with potential as gene delivery vehicles. The application of this
approach allowed the identification of a candidate with a remarkable (one order of magnitude in vitro) improvement in delivery efficiency and cellular toxicity compared to typical commercial reagents. Remarkably, this candidate has also recently proven highly active for in vivo delivery of mRNA in mice, which suggests that it can be an excellent non-viral vector for the formulation of mRNA vaccines with a boosted potency, due to the uptake enhancement provided by this conceptually-new delivery vector.
COV20_00308Análisis de marcadores solubles de activación inmunológica y de poblaciones de células NK y T CD8 en pacientes con infección por SARS-CoV-2FUNDACION INSTITUTO DE INVESTIGACION SANITARIA ARAGONJulián Pardo, José Ramón Paño PardoEste estudio pretende generar conocimiento sobre las poblaciones de células inmunes
encargadas del control de la infección, para poder comprender la cinética y magnitud de la respuesta inmune durante la enfermedad COVID-19. Este conocimiento puede identificar biomarcadores que contribuyan a: 1) identificar qué pacientes tendrán mayor probabilidad de experimentar insuficiencia respiratoria requiriendo ingreso y tratamiento de soporte respiratorio en unidades de cuidados intensivos, 2) monitorizar la evolución de la infección y 3) explorar nuevas intervenciones terapéuticas. Todo esto no solo busca contribuir a personalizar el tratamiento en función del perfil y respuesta inmunológica de cada paciente, sino que también redundará en una reducción del estrés del sistema sanitario al poder predecir con anterioridad los pacientes que pueden desarrollar cuadros clínicos más graves y por tanto planificar y optimizar el uso de los recursos disponibles por el sistema de salud
COV20_00357Prevalencia de COVID-9 en pacientes con artritis inflamatoria crónica en tratamientoFUNDACION INSTITUTO DE INVESTIGACION VALLE DE HEBRONSara Marsal BarrilLos pacientes con artritis inflamatorias crónicas (AIC) tienen un riesgo incrementado de infecciones tanto por la desregulacion del sistema inmune como por el tratamiento inmunosupresor. La evidencia preliminar en nuestro servicio indica una menor tasa de contagio por el SARS.CoV-2 en pacientes con AIC que reciben tratamiento inmunosupresor que la reportada para la población general (<1%). Se trata de un estudio transversal de una cohorte muy bien caracterizada de N=1.175 pacientes con AIC que reciben tratamiento con inmunosupresores selectivos (ISS), tanto adultos como en edad pediátrica, seguidos de forma sistemática en n hospital universitario de tercer nivel. Se obtendrán datos epidemiológicos y clinicos a partir de la historia clínica electrónica, la historia clinica compartida de Catalunya y a través de una encuesta telefónica. Se determinará la prevalencia y expresión clínica de COVID-19 en estos pacientes lo que permitirá establecer recomendaciones de práctica clínica con gran impacto científico y social.01/05/2020
COV20_00370Multicenter study of coronavirus disease 2019 (COVID-2019) in Solid Organ Transplant RecipientsFUNDACION PUBLICA ANDALUZA PARA LA GESTION DE LA INVESTIGACION EN SALUD DE
Maria Elisa Cordero MatiaNo information exists regarding COVID-19 in solid organ transplant recipients (SOTR).
Besides, treatment is challenging as drug interactions might have an important impact on drug toxicity, graft dysfunction and rejection and probably outcome is adverse. No specific recommendations regarding COVID-19 exist. Objectives: to better understand the incidence, risk factors, clinical manifestations and outcome of COVID19 in SOTR. The results obtained will allow us to gain insight on the need of antiviral treatment, on the strategy for complications surveillance, on how to adjust the immunosuppressant therapy and on the level of care in which each patient should be treated. Design: Multicenter prospective study of consecutive cases of COVID-19 in SOTR. There will be a clinical follow-up of the patients included in this study to observe possible complications and survival rate.
COV20_00401Fibrosis pulmonar residual y capacidad pulmonar en sobrevivientes de SARS-CoV-2FUNDACION RIOJA SALUDJosé Ramón Blanco RamosTras la epidemia de por el síndrome respiratorio agudo grave por coronavirus (SARS-CoV) (2003/2003), muchas de las personas que sobrevivieron desarrollaron una fibrosis pulmonar (FP) residual. Las autopsias de estos pacientes con SARS mostró la presencia de fibrosis pulmonar en las diferentes etapas de la infección. Riesgo de FP fue más elevado en las personas de edad más avanzada, y se correlacionó con la gravedad clínica y la duración de la enfermedad. Por otro lado, en las biopsias pulmonares se observó una desregulación de la respuesta inflamatoria, estando especialmente elevados los niveles séricos de ciertas citoquinas proinflamatorias. Además, la infección
por SARS-CoV induce una hiperactivación de la vía de TGF-􀑛 que conduce a la fibrosis pulmonar.
COV20_00404Pronóstico de los pacientes infectados por el nuevo coronavirus SARS-CoV-2FUNDACION INSTITUTO DE INVESTIGACION SANITARIA DE SANTIAGO DE COMPOSTELAFrancisco Gude SampedroDebido a que aproximadamente u n 14% de pacientes infectados por el SARS-CoV-2 presentan cuadros clínicos severos y un 5% requieres cuidados críticos, el avance del virus está produciendo una sobrecarga en el sistema sanitario. En este contexto, el uso de modelos predictivos para identificar lso sujetos más vulnerables se convierte en un objetivo prioritario. Utilizando datos recogidos de los registros electrónicos de salud, este proyecto pretende: 1) la contrucción de algoritmos de supervivencia, y de clasificación para estimar el riesgo de los pacientes; y 2) en base a los tratamientos administrados a los pacientes, mediante la utilización de modelos de inferencia causal, cuantificar la efectividad de los fármacos de acuerdo a las características de los pacientes.01/05/2020
COV20_00420COVID-19 en pacientes con  insuficiencia CARDIACA Y CARDIOPATIAS FAMILIARES
Ámbitos de
Juan Ramón Gimeno BlanesSe creará una plataforma online para el registro de casos de pacientes con insuficiencia cardiaca previa o cardiopatías familiares en los que se confirme infección CoViD19. Será un registro anonimizado al que se accederá con usuario y contraseña a través de la Web e incluirá datos demográficos básicos, diagnósticos previos, sintomatología, tratamientos previos y durante el episodio, intervenciones necesarias durante el ingreso y eventos. Se generará una base de datos común a partir de la que se podrán visualizar los datos agrupados y realizar los análisis estadísticos correspondientes. Los datos estarán disponibles desde el inicio del proyecto para las autoridades sanitarias y para los participantes en el registro. El registro se mantendrá activo al menos 2 años para poder recopilar datos de forma retrospectiva de pacientes en seguimiento previo en consultas, y para la incorporación de información sobre evolución y complicaciones a corto y medio plazo. 01/05/2020
COV20_00421Estudio epidemiológico e implicaciones clínico-moleculares de la angiotensina en el pronóstico de la infección por SARS-Cov-2Instituto de Investigación Sanitaria Biocruces BizkaiaMaria Sonia Gaztambide SaénzEstudio epidemiológico y expresión de polimorfismos en pacientes con infección por COVID-19 en tratamiento con IECA o ARAII. Se pretende establecer la asociación y el impacto entre la infección por COVID-19 y el tratamiento crónico con IECA o ARAII, en términos de una evolución clínica tórpida-fatal. Estos fármacos aumentan la expresión de ECA2, vehículo de entrada a las células diana en el síndrome agudo respiratorio por SARS.CoV/SARS CoV-2. Se pretende establecer la relación entre la carga viral y la predisposición genética identificando polimorfismos y su expresión ligados a esta enzima, relacionada con enfermedades como: diabetes, HTA e ictus y sus tratamientos; tratando de desarrollar ensayos clínicos que permitan identificar terapias más eficientes en una población con una elevada mortalidad.01/05/2020
COV20_00429Interacción entre SARS-COV-2 y el epitelio respiratorio humano: secuestro de vías de endocitosis y exocitosisUniversidad de ExtremaduraJosé María Carvajal GonzálezLas vías de entrada de un patógeno en nuestro cuerpo está fundamentada en la rotura de nuestras barreras fisiológicas. En el caso de las vías respiratorias, el epitelio es de las primera barreras que presenta el cuerpo humano. El traspaso viral de este epitelio tiene dos alternativas: 1) el espacio paracelular, lo cual implicaría el desensamblado de las uniones estrechas y adherentes entre células vecinas, y 2) realizando un proceso de transporte intracelular, tomando el virus para su beneficio las rutas de tráfico intracelular. Este proyecto tiene como objetivo 1 estudiar cómo entra el virus en nuestro cuerpo a través de las células epiteliales de las vías respiratorias humanas . Por otro lado la liberación de nuevos virus al lumen de las vías respiratorias puede deberse a la exocitosis de los virus. Este proceso necesitaría del uso de las vías de secreción que usan las células de manera natural. Este proyecto en su objetivo 2 estudiará la exocitosis del SARS-CoV2 en células epiteliales de las vías respiratorias humanas. Además, el desarrollo del Objetivo 1 y 2 concluirán con el desarrollo de dos plataformas de cribado, permitiendo buscar fármacos que bloquee la entrada o salida del virus directamente en epitelios de vías respiratorias.01/05/2020
COV20_00459CARACTERIZACIÓN CLÍNICA DE LA INFECCIÓN POR COVID19: ESTRATIFICACIÓN PRONÓSTICA Y COMPLICACIONESASOCIACION INSTITUTO DE INVESTIGACION EN SERVICIOS DE SALUD-KRONIKGUNESusana García GutiérrezObjetivos:1.-Crear escalas de estratificación del riesgo de mala evolución en pacientes infectados por CoVid19, y perfil evolutivo de los enfermos; 2.-Valorar efectividad del tratamiento y pruebas diagnosticas; 3-Evaluación de accesibilidad, equidad, variabilidad y costes. Métodos: Información extraída manual/automáticamente de la historia clínica electrónica de parámetros tales como antecedentes epidemiológicos, iniicio de síntomas, manifestaciones clínicas, pruebas realizadas, tratamientos y evolución hasta 3 meses tras el alta. Análiisis estadístico: mediante modelos clásicos de supervivencia, regresión logística, modelos generalizados lineales y también análisis mediante técnicas de inteligencia artificial que evalúen el riesgo de mala evolución. Se valora costes de la atención sanitaria. Se derivarán como producto aplicaciones para toma de decisión01/05/2020
COV20_00470Efecto del consumo de medicamentos antes y durante la infección por SARS-COV-2 en la evolución de pacientes con COVID-19. Un estudio de cohortes de base poblacional.FUNDACIÓN INSTITUTO INVESTIGACIÓN SANITARIA DE SANTIAGO DE COMPOSTELAAdolfo Figueiras GuzmánExisten importantes inconsistencias y falta de evidencia sobre el efecto de los tratamiento con antihipertensivos del tipo IECA y/o ARAII y de algunos AINE podrían ser factor de riesgo de gravedad e incluso de mortalidad por COVID-19. Ello favorece los rumores y los errores en la información, que pueden incidir negativamente en la Salud Pública y en la toma de decisiones. Por ello, con este estudio pretendemos valorar si el consumo previo de determinados medicamentos (IECAs, ARA 2 condiciona una mayor susceptibilidad a la infección por SARS-COV-2; e identificar aquellos tratamientos recibidos antes y después de la infección que se asocian a una mejor evolución y mayor supervivencia. Para ello se utilizarán registros poblaciones de Galicia, mediante la plataforma de big data HEXIN .01/05/2020
COV20_00519VARIABLES PRONÓSTICOS. RECUROS CONSUMIDOS Y COSTE HOSPITALARIO DE PACIENTES INGRESADOS POR INFECCIÓN SARS-COV-2 SEGÚN SU FRAGILIDADFUNDACION INVESTIGACION BIOMEDICA HOSPITAL LA PAZEva María Andrés EstebanEn el momento actual, el COVID-19 ha generado la mayor crisis de salud pública, llegando a poner el sistema sanitario de salud en grave riesto de colapso. Así, a mediados de marzo fue necesario recurrir al estado de emergencia nacional e imponer un confinamiento domiciliario que se mantendrá al menos hasta mediados de abril, con grandes probabilidades de prórroga. Durante este tiempo, todos los servicios de nuestros hospitales, y en especial el servicio de urgencias y cuidados intensivos, se van completamente salurados, superando el 100% de la capacidad existente. En este auténtico caos, se están habilitando carpas y pabellones para poder atender el cada vez más numerosos número de pacientes con síntomas leves, moderados o graves de la enfermedad. Además, el rpnóstico, asi como la presentación clínica, es muy variable no existiendo evidencia empírica que corrobore estas diferencias. En este proyecto queremos estratificar la población infectada según diferentes estadios de fragilidad, tento para estudiar la diferencia en evolución como en utilización de recursos hospitalarios.01/05/2020
COV20_00527Estudio de cohortes retrospectivos para evaluar el efecto de los AINE's y los IECA'S en el pronóstico de pacientes sintomáticos con COVID-19.ASOCIACION INSTITUTO DE INVESTIGACION SANITARIA BIOARABARaquel Cobos CamposDeterminar si los pacientes con infección confirmada por SARS-CoV-2, tratados con fármacos que aumentan l expresión de enzima convertidora de angiotensina 2 8IECAS,BRA y/o AINE's) tienen más riesto de mala evolución de la enfermedad (neumonía, síndrome respiratorio agudo y afectación cardiaca), mortalidad o ingreso hospitalario que los pacientes no tratados con estos fármacos. Se plantea un estudio retrospectivo de todos los pacientes con infección confirmada por el virus SARS-CoV-2 en Alava. Se realizará un seguimiento de todos los pacientes con infección confirmada desde el primer contacto con el sistema sanitario hasta resolución de la misma (negativización del test) o el fallecimiento en su caso. Los datos precederán de la histoia clínica electrónica de cada paciente.01/05/2020
COV20_00532Modelos pre-clínicos en ratón para el estudio de Covid19 y ensayo de estrategias terapéuticasFUNDACIÓN DEL SECTOR PÚBLICO ESTATAL CENTRO NACIONAL DE INVESTIGACIONES ONCOLÓGICAS CARLOS IIISagrario Ortega JiménezEl objetivo último de esta propuesta es desarrollar un ratón modificado genéticamente, susceptible de ser infectado por el virus SARS-CoVi-2. Proponemos dos modelos. El primero consiste en un modelo knockin en el que el gen Ace2 murino es reemplazado por la secuencia codificante de su homólogo humano. Sabemos que ratones knockout de Ace2 desarrollan fenotipos que pueden no ser rescatados por la expresión de la proteína humana. Por tanto, y en paralelo, proponemos la generación de un modelo transgénico, mediante un BAC que contenga todas las secuencias reguladoras de la expresión del gen Ace2 murino, y en el cual se reemplace la secuencia codificante de dicho gen por la del gen humano (cDNA). En ambos modelos, concomitante con la expresión de la proteína ACE2 humana, se expresará la proteína fluorescente tdTomatoo, para poder detectar y aislar fácilmente las células susceptibles de ser infectadas por el virus SARS-CoVi-2.01/05/2020
COV20_00542Infección, hospitalización, ingreso en UCI y fallecimiento por SARS-CoV-2 en una cohorte poblacionalFUNDACION INSTITUTO DE INVESTIGACION SANITARIA DE NAVARRAJesus Castilla CatalánObjetivo: estimar el efecto de características sociodemográficas, enfermedades crónicas y otras condiciones en el riesgo en la infección, hospitalización y formas graves de COVID-19. Métodos: A partir de bases de datos asistenciales y de vigilancia epidemiológica se construirá la cohorte de población cubierta por el Servicio de Salud (640.000 personas). Se definirán dos sub-cohortes para análisis específicos: personas institucionalizadas (n=6000) y de profesionales sanitarios (n=12.000). Se calcularán las tasas de incidencia de casos con sospecha clínica, de infección confirmada mediante PCR, de hospitalizaciones, de ingresos en UCI, de ventilación asistida y de mortalidad. También se calculará la letalidad en los casos confirmados y en hospitalizados. Las variables predictoras que se evaluarán son el sexo, edad, enfermedades crónicas, embarazo, obesidad, hipertensión, tabaquismo, capacidad funcional, nivel socioeconómico, número de convivientes, menores en el domicilio y utilización de servicios. Se evaluará la seroprevalencia de anticuerpos en una muestra de pacientes de la red de médicos centinela y/o de donantes.01/05/2020
COV20_00580Estudio de la carga viral de SARS-CoV-2 en vías respiratorias y sangre como factor asociado al pronóstico de la COVID-19 en adultosFundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (FISEVI)Javier Sánchez CéspedesEl objetivo general es analizar la influencia de la carga viral de SARS-CoV-2 en vías respiratorias inferiores (esputo o muestras invasivas si su estudio está indicado), así como en sangre y heces como indicadores de enfermedad diseminada, como factores asociados al desarrollo de neumonía y a la evolución de la enfermedad, medida por necesidad de ventilación asistida y la curación o fallecimiento. Las variables virológicas se incluirán en un análisis junto a variables demográficas, comorbilidades y las características clínicas y radiológicas de la neumonía. También, se evaluará la sensibilidad de la RT-PCR de SARS-CoV-2 en frotis nasofaríngeos . el esputo y la viremia. Finalmente, se determinará la excreción e infectividad del virus en heces tras la curación de los pacientes01/05/2020
COV20_00587Elaboración de cartografías de peligrosidad de transmisión del COVID19 en espacios urbanos orientadas a la aplicación de medidas anti-propagación a escala de detalleUNIVERSIDAD DE MALAGAMARIA JESÚS PERLES ROSELLÓEl proyecto tiene como objetivo analizar cuál es el comportamiento espacial de transmisión del virus Covid_19 en espacios urbanos, a fin de conocer dónde se ubican los principales focos de contagio, cuáles de ellos son más virulentos y evolucionan a un ritmo más rápido, con qué factores urbanos se relacionan, y cuáles son los espacios clave de actuación mediante medidas anti-contagio para frenar la propagación. Entendemos que el seguimiento espacial del contagio a nivel de micro-escala urbana es clave para cortar la cadena de transmisión del virus. El ámbito espacial de estudio está constituido por los espacios urbanos de la provincia de Málaga, incluida su capital, área urbana en la que ya se están obteniendo resultados.01/05/2020
COV20_00595Caracterización y manejo del Síndrome Post Cuidados Intensivos en pacientes COVID-19FUNDACIÓ PARC TAULÍSOL FERNANDEZ GONZALOImplementación de un sistema de seguimiento combinado (soluciones tecnológicas y visitas presenciales) en pacientes que han superado un episodio crítico por COVID-19 para caracterizar el síndrome Post-Cuidados Intensivos y detectar de forma precoz necesidades de tratamiento específico o rehabilitación física y cognitiva. El seguimiento se hará de forma presencial al alta de la UCI y a los 12 meses del alta de la UCI, y mediante el uso de aplicaciones móviles y llamadas telefónicas al mes, a los 3 meses y a los 6 meses tras alta de UCI. Se elaborará un árbol diagnóstico para detectar a los supervivientes de enfermedad crítica por COVID-19 que presenten alteraciones físicas, cognitivas y emocionales moderadas-graves a los 3 meses del alta a UCI. A estos pacientes se les ofrecerá una visita presencial extraordinaria con un especialista a los 6 meses.01/05/2020
COV20_00622Determinantes Genéticos y Biomarcadores genómicos de riesgo en pacientes con infección por coronavirus SARS-COV-2Consorcio Centro de Investigación Biomédica en Red M.P. (CIBER)  Angel Carracedo Alvarez (PI) Pablo Lapunzina (Co-PI)Objetivo: Búsqueda de biomarcadores genómicos de riesgo que puedan predisponer a infección más grave estratificación pronóstica y/o biomarcadores genómicos de respuesta en pacientes que hayan recibido tratamiento durante la infacción. Se realizará un estudio de asociación de genoma completo (GWAS) en una muestra de 7000 pacientes españoles y un estudio de secuenciación de genoma completo en un grupo de pacientes seleccionados (300), recogidos por un consorcio nacional e internacional que incluye más de 15 hospitales, complementado con grupo de investigación de alto nivel. Los datos clínicos (signos, síntomas y hallazgos) y los antecedentes personales y epidemiológicos se recogerán en una base de datos común diseñada ad hoc para este proyecto. Encontraremos así determinantes genético/genómicos de riesgo y mala evolución que permitan una mejor estratificación de los pacientes y la adecuación y optimización de protocolos terapéuticos.01/05/2020
COV20_00634Variables pronósticas, recursos consumidos y coste en atención primaria de pacientes don COVID-19Instituto de Investigación Sanitaria de AragónRosa Magallón BotayaEste proyecto va a ser liderado por la Dra Rosa Magallón Boyata, investigadora Principal del Grupo Consolidados de Investigación en Atención Primaria del Gobierno de Aragon. En el momento actual, el COVID-19 ha generado la mayor crisis de salud pública, llegando a poner el sistema sanitari de salud en grave riesgo de colapso. Asi, a mediados de marzo fue necesario recurrir al estado de emergencia nacional e imponer un confinamiento domiciliario que se mantendrá, al menos, hasta mediados de abril, con grandes probabilidades de prórroga. Durante este tiempo, los servicios sanitarios se han visto completamente desbordados. En esta nueva situación, se están habilitando carpas y pabellones para poder atender el cada vez más numeroso número de pacientes con síntomas leves, moderados o graves de la enfermedad, derivando recursos de otros niveles asistenciales. Además, el pronósticos, así como la presentación clínica, es muy variable no existiendo evidencia empírica que corrobore estas diferencias. En este proyecto queremos estratificar la población infectada que no requiere ingreso hospitalario, sus factores prodisponentes, comorbilidad y fragilidad, así como analizar la utilización de recursos en AP en esta pandemia en nuestro pais.01/05/2020
COV20_00668Caracterización y manejo terapéutico de la hiperactivación inmunológica asociada a mortalidad en COVID-19FUNDACIÓN PARA LA INVESTIGACIÓN BIOMÉDICA DEL HOSPITAL GREGORIO MARAÑÓNRafael Correa RochaEl deterioro clínico de la infección por SARS-CoV-2 sería el resultado de una combinación de efectos citopáticos directos inducidos por el virus y la inmunopatología inducida por un síndrome de liberación de citoquinas asociado a la respuesta inmune frente al virus. La experiencia que se va adquiriendo en nuestros centros indica que en los casos más graves el cuadro clínico se relaciona sobretodo con la activación de una respuesta inmune exagerada y un proceso inflamatorio incontrolado, que conduce a un fallo multiorgánico que acaba en fallecimiento. Un reciente estudio de 150 casos confirmados de COVID-19 en Wuhan, acaba de identificar la ferritina elevada y la IL-6 como los principales predictores de mortalidad, lo que confirma que la hiperinflamación provocada por la respuesta frente a SARS-CoV-2 sería la principal causa de mortalidad en COVID-19. Nuestro proyecto pretende hacer un estudio exhaustivo del estado inmunológico del paciente: i) instaurando una monitorización temprana de citoquinas para orientar el uso dirigido y personalizado de fármacos biológicos, con el fin de rescatar de una muerte probable a los pacientes con peor evolución; ii) estudiando los factores inmunológicos asociados a riesgo relativo, progresión y también a el desarrollo de inmunidad frente al virus.01/05/2020
COV20_00675Registro de la infección por SARS-CoV-2 en pacientes con hemoglobinopatías y/o esplenectomizados: vigilancia epidemiológica y estudio de la morbilidad y mortalidad en grupos de riesgoFUNDACION INVESTIGACION BIOMEDICA HOSPITAL GREGORIO MARAÑONElena Cela de JuliánEl registro de la infeccion por SARS-CoV-2 en pacientes pediátricos con hemoglobinopatías con gravedad clínica, como la Enfermedad de células falciformes (ECF) o Talasemia major(TM), entre otras y/o pacientes esplenectomizados pretende recabar información epidemiológica relevante para la vigilancia de este grupo de riesto; se pretende estudiar la morbilidad y mortalidad en esta población además de la cuantificación de los recursos utilizados por esta población durente la situación epidémica actual (tasa de hospitalización, tratamientos utilizados , tasa de ingreso en unidades de cuidados intensivos, entre otros marcadores), Se trata de un estudio observaciones, descriptivo, multicéntrico y ambispectivo. Con este estudio se quiere estudiar el impacto socioeconómico y la epidemiología de la enfermedad COVID-19 en este grupo poblacional.01/05/2020
COV20_00698Creación de la Cohorte de pacientes COVID19 y muestras asociadas a Biobanco del Instituto de Investigación Sanitaria Galicia Sur (IISGS)FUNDACIÓN BIOMÉDICA GALICIA SUREVA POVEDA LÓPEZLa creación de la cohorte de pacientes COVID19 y muestras asociadas a Biobanco del IISGS en el área sanitaria de Vigo supone la base para el estudio de la enfermedad COVID19 de forma estandarizada y de calidad. Permitirá la ejecución de estudios clínicos y experimentales para incrementar nuestro conocimiento y optimizar la prevención, diagnóstico, seguimiento clínico y tratamiento de los pacientes infectados por SARS-COV-2 a nivel local y global favoreciendo los consorcios y grupos de estudio con otros centros nacionales e internacionales para el desarrollo de proyectos de investigación conjuntos. Para ello, se ha creado una Unidad de Coordinación de la Cohorte COVID19-IISGS y un Comité Científico-técnico para la evaluación de los proyectos de investigación que requieran la utilización de datos y muestras de la cohorte una vez que cuenten con la aprobación de los Comités de Ética pertinentes.01/05/2020
COV20_00808Aspectos clínicos e inmunovirológicos de la infección por SARS-CoV2 en una cohorte de gestantes y recién nacidos.FUNDACION INVESTIGACION BIOMEDICA HOSPITAL GREGORIO MARAÑONMaria Luisa Navarro GómezEstudio multicéntrico prospectivo nacional realizado en centros asistenciales de RECLIP. Se analizarán al menos 150 parejas madres-recién nacidos con infección confirmada por SARS-CoV2 durante la gestación. Se recogerán aspectos epidemiológicos, clínicos, tratamientos de la infección, evolución. En 50 parejas se llevarán a cabo estudios microbiológicos de SARS-Cov-2 en muestras respiratorias, sangre, placenta, orina y heces del recién nacido, leche materna, e inmunológicos en el momento del diagnóstico de la gestante y al nacimiento en el recién nacido, y de forma prospectiva hasta los 6 meses de vida del lactante, encaminados a conocer en profundidad la transmisión de la infección así como la respuesta inmune que se produce en estas poblaciones frente a SARS-CoV-201/05/2020
COV20_00852Incidencia y caracterización de perfiles de bajo/alto riesgo de complicación en personas >60 años con COVID19.IDIAP JORDI GOLÁNGEL VILA CÓRCOLESEstudio de cohortes de base poblacional, con seguimiento retrospectivo-prospectivo de 4 meses (01/03/2020-30/06/2020), que incluirá 48.000 personas >60 años de Tarragona (1.500 de ellas institucionalizadas). Objetivos: (i) conocer la incidencia real de infección por COVID-19, discriminando según casos “confirmados” (PCR+) y/o “sospechosos”(COVID19-like sin confirmación PCR); (ii) identificar la frecuencia de presentación (inicial y durante la evolución) de síntomas y signos de la enfermedad en ambos tipos de pacientes (confirmados/sospechosos); (iii) caracterizar el perfil de presentación clínica (síntomas y signos) de la infección por COVID-19 en la población y explorar modelos de predicción de perfiles de bajo/alto riesgo de complicación (empeoramiento brusco, necesidad de hospitalización/UCI, muerte) en función de posibles covariables predictoras (sexo, edad, síntomas/signos, comorbilidad y medicación previa).01/05/2020
COV20_00901Virus Vaccinia MVA dual para la inmunización contra el SARS-CoV-2
Rafael Blasco LozanoPara una mayor efectividad y potencia, una vacuna ideal debe inducir respuesta de memoria tanto humoral como celular. Disponemos de metodología puesta a punto para obtener virus vaccinia MVA recombinantes que expresen simultáneamente dos antígenos desde dos locus separados del genoma, sin inactivar ningún gen del virus que pueda atenuar la respuesta. En el caso del Covid-19, parece probable que la proteína S induzca buenos anticuerpos neutralizantes pero una pobre respuesta celular (1), por lo que proponemos generar candidatos vacunales que potencien la respuesta de células T expresando, además de la glicoproteína S del SARS-CoV-2, la proteínas ns1/2 o N. Estos
candidatos vacunales deben ser capaces de inducir inmunidad humoral además de  nmunidad celular contra epítopos conservados en proteínas intracelulares. Una vez generados los virus recombinantes, se evaluará su capacidad inmunogénica en modelos de ratón.
COV20_00923Seroprevalencia frente a SARS-CoV-2 en embarazadas y recién nacidosFUNDACION INSTITUTO DE INVESTIGACION MARQUES DE VALDECILLA (IDIVAL)Javier Llorca Díaz / María Jesús Cabero PérezEstudio de cohortes incluyendo 1000 gestantes y sus 1000 recién nacidos en la comunidad de Cantabria, que serán seguidos durante un año. Se realizarán determinaciones de IgG e IgM antiSARS-CoV-2 en la madre en la primera consulta de embarazo, el día del parto y a los 6 y 12 meses del parto; en el recién nacido el día del nacimiento y a los 6 y 12 meses. Se recogerá información sociodemográfica y del proceso de atención al embarazo y el parto. En el seguimiento, se evaluará la somatometría y el desarrollo psicomotriz del recién nacido.01/05/2020
COV20_00943Factores inmunológicos y virológicos en COVID-19 y su correlación con la evolución a formas graves de la enfermedad.FUNDACION INSTITUTO DE INVESTIGACION SANITARIA ILLES BALEARSMercedes García GasallaEstudio prospectivo que se realizará en los Hospitales Son Espases y Son LLátzer de Palma de Mallorca, cuyo objetivo es identificar factores virológicos e inmunológicos, además de clínicos, radiológicos y analíticos, relacionados con las formas graves de COVID-19. Durante los meses de abril y mayo de 20120, se reclutarán 150 pacientes diagnosticados de COVID-19 leve, grave y moderado (50 pacientes en cada grupo) y se realizará determinaciones en sangre periférica de niveles basales y a las 2 semanas de IL1, IL6, IL8, IL10, TNFa e IL2R, de subpoblaciones linfocitarias y estudio del complemento, así como estudio de carga viral semicuantitativa en orofarínge y sangre periférica y producción de Ac frente frente a SARS-COV-2. Se analizará la relación de estos parámetros con variables epidemiológicas, clínicas y radiológicas de la COVID-2 leve, grave y moderada.01/05/2020
COV20_00948EMCOVID-19: Esclerosis Múltiple y COVID-19INSTITUTO INV. BIOMEDICA DE LLEIDA. FUNDACION DR. PIFARRE (IRBLLEIDA)Luís Brieva RuizLa EM es una enfermedad autoinmune y todavía no se ha estudiado su interacción con la infección por COVID-19. Esto resulta importante varios motivos. 1) la infección por COVID-19 podría modificar la evolución de la EM 2) La EM podría alterar la respuesta frente al COVID-19. Tampoco se ha estudiado la evolución de la infección según el tratamiento inmunomodulador (TME) recibido y si este altera la evolución de la EM. En esto pretendemos estudiar a) cómo el contagio por SARS-COV-2 afecta al estado clínico e inmunológico del pacientes con EM en función de las características de su EM y el TME que toman, b) cómo la EM y el tratamiento con TME influyen en la aparición y desarrollo de la infección por SARS-COV-2 y c) si existen efectos beneficiosos de algunos TME en la evolución de la infección por SARS-COV-2 o si algunos fármacos utilizados en el tratamiento de la infección podrían ser beneficiosos para el tratamiento de la EM.01/05/2020
COV20_01100CoviNanoVax: Diseño de una vacuna de mRNA basada en nanopartículas poliméricas dirigidas a las células dendríticasUNIVERSIDAD RAMON LLULL Salvador Borrós/Cristina FornagueraCoviNanoVax surgió a raiz de nuestra experiencia previa en el desarrollo de nanosistemas poliméricos cargados de material genético dirigidos selectivamente a células dendríticas (DCs). Estos nanosistemas se usarán aquí como vacunas para la prevención del CoVid19. Se encapsulará un mRNA codificante para las proteínas antigénicas de la nucleocápside del SARS-CoV-2, para que, una vez inyectadas las nanopartículas en un paciente sano, se dirijan selectivamente a las DCs y las transfecten. Al ser un mRNA codificante sólo de las proteínas antigénicas, y teniendo en cuenta que no estará presente la retrotranscriptasa, la seguridad de la vacuna será muy alta y, a la vez, siendo el mRNA una macromolécula muy antigénica, desarrollará una respuesta inmune específica para inmunizar a personas sanas pero susceptibles y protegerlas frente a futuras infecciones de SARS-CoV-2.01/05/2020
COV20_01112EPICOS- Ensayo clínico para la Prevenciónde la Infección por Coronavirus en SanitariosFUNDACIÓN ESTATAL, SALUD, INFANCIA Y BIENESTAR SOCIAL, F.S.P.Julia del Amo ValerEnsayo clínico aleatorizado para evaluar la eficacia de la dosis diaria en comprimido único de Tenofovir (TDF) (245 mg) Emtricitabina (FTC) (200 mg), dosis diaria en comprimido único de Hidroxicloroquina (HC) (200 mg), y dosis diaria de TDF (245 mg)FTC (200 mg) más HC (200 mg) o placebo, durante 12 semanas en: (1) disminución de la incidencia de enfermedad sintomática y 2) disminución de la severidad clínica de la infección por coronavirus (COVID-19) en personal sanitario hospitalaria de 18 a 65 años expuesto a la infección por coronavirus (COVID-19) en España.01/05/2020
COV20_01138Registro de pacientes con enfermedades inflamatorias y autoinmunes con infección SARS-CoV2FUNDACION INSTITUTO DE INVESTIGACION MARQUES DE VALDECILLA (IDIVAL)Ricardo Blanco Alonso / Miguel Ángel González-GayEl proyecto trata de generar un registro de todos los pacientes con diagnóstico de infección por SARS-CoV2 y enfermedad reumatológica diagnosticada previamente. Para ello, se recogerán datos de la HCE de pacientes SARS-CoV2 + y enfermedades reumatológicas en relación a su enfermedad de base, a su tratamiento previo, al tratamiento que se estaba utilizando cuando comenzaron los síntomas de la infección, el curso de la enfermedad hasta su resolución, incluyendo la aparición de complicaciones, las terapias usadas como tratamiento y presencia de factores de riesgo. El objetivo es analizar posteriormente los datos obtenidos con el fin de determinar cual es la influencia de las enfermedades reumatológicas en el curso de la infección y si las terapias administradas pueden ser beneficiosas o perjudiciales en términos de profilaxis y/o menor o mayor gravedad de la infección.01/05/2020
COV20_00052Identificacion de inhibidores de la proteasa Mpro del virus COVID-19 por repovisionamiento de medicamentosUniversidad Politecnica de CatalunyaJuan Jesus Perez GonzalezEl proyecto tiene como objetivo el descubrimiento de inhibidores de la proteasa Mpro del virus SARS-CoV-2 por reprovisionamiento de medicamentos como nuevos agentes antivirales. Para ello se utilizaran metodos de diseño de farmacos asistido por ordenador. El proceso incluye la preparacion de la estructura de la diana mediante dinamica molecular, el cribado molecular usando un algoritmo de anclaje molecular y el calculo de la energia libre de union de los mejores ligandos. Para realizar el cribado virtual se utilizaran bases de datos de moleculas aprobadas como agentes terapeuticos y de productos naturales. El resultado final sera una lista ordernada por afinidad de diversas moleculas que puedan ser probadas in vitro.06/05/2020
COV20_00211Estudio para la identificación de perfiles de citoquinas capaces de predecir el desarrollo de distress respiratorio secundario a infección por coronavirus 2 (SARS-CoV-2) )FUNDACION DE INVESTIGACION HM HOSPITALESJesus Garcia-Donas JimenezRealizaremos , por espacio de una semana, extracciones sanguíneas diarias a una cohorte de 100 pacientes actualmente ingresados en el Hospital HM Sanchinarro con diagnóstico confirmado o de alta sospecha de COVID-19 . En estas muestras se determinará un panel amplio de citoquinas (LUMINEX) correlacionando, de forma prospectiva, los resultados analíticos con el desarrollo de SARS grave. Mediante algoritmos informáticos estableceremos las determinaciones que mejor predigan la aparición de esta complicación. El análisis se centrará en proteínas incluidas en el portfolio de las casas comerciales que producen, a escala industrial, kits diagnósticos mediante ELISA. Así, los marcadores hallados estarán disponibles de forma inmediata en cualquier centro asistencial del país. En paralelo, estudiaremos la variabilidad genética interindividual y la evolución de la carga viral en estos casos. En una segunda fase desarrollaremos kits multiplex más precisos y patentables.06/05/2020
COV20_00491Evolución del perfil inflamatorio y estatus redox en pacientes COVID-19: ¿Posibles dianas terapéuticas?Hospital Clínico Universitario de ValladolidEduardo Tamayo GómezEl riesgo de los pacientes con COVID19 aumenta con la edad al igual que el estatus redox y el componente inflamatorio. En relación la hipótesis de este trabajo es que en los pacientes COVID19 existe un perfil inflamatorio asociado a la severidad de la enfermedad que evoluciona dependiendo de la capacidad que presente el paciente para estabilizar su estatus redox. Los objetivos de este trabajo son realizar una caracterización clínica biológica y molecular de la enfermedad Covid19 así como establecer una de dianas terapéuticas innovadoras y de biomarcadores pronóstico de actividad clínica e incluso muerte que pueden reducir considerablemente la tendencia de mortalidad que actualmente sufre nuestro país.06/05/2020
COV20_00508EVALUACION DE LA RESPUESTA INMUNE ESPECIFICA FRENTE AL SARS-CoV-2Fundacio Institut del Mar d´Investigacions MediquesRAMON GIMENO MARTINEZEl control de la infección por SARS-CoV-2 se fundamenta en el desarrollo de una respuesta inmunológica eficaz frente al virus y en la aparición y mantenimiento de linfocitos T de memoria que puedan activarse si el virus reaparece. La generación de linfocitos T de memoria también es necesaria para asegurar la eficacia de las estrategias de vacunación. Mediante técnicas celulares (ELISPOT, citometría de flujo) estudiaremos las características de la respuesta inmunitaria en pacientes que hayan resuelto la infección, independientemente de sus manifestaciones clínicas. Además, analizaremos la evolución de la infección y la respuesta inmunitaria en pacientes con enfermedades inflamatorias crónicas para estudiar si los tratamientos inmunosupresores (biológicos o farmacológicos) han podido tener alguna incidencia, positiva o negativa, en el curso de la infección y en la instauración de la memoria inmunológica.06/05/2020
COV20_00652Determinants of resistance and pathogenicity in SARS-CoV-2 infection: genomic and biochemical mechanismsUniversidad de OviedoCARLOS LÓPEZ OTÍN / ALEJANDRO LÓPEZ SOTOThe clinical management of COVID-19 patients and the implementation of measures to prevent, alleviate and eventually eradicate the disease will require not only a complete characterization of the structural and biological features of the virus, but also a deep understanding of the molecular intricacies of the virus-host cell interaction. In this project we will carry out comparative studies aimed at identifying viral and host genomic features involved in pathogenicity and disease susceptibility. We will also study the role of cellular proteases involved in SARS-CoV-2 infection and explore their regulatory mechanisms, their endogenous inhibitors and their potential role in aging-associated disease vulnerability. These studies will be complemented with a CRISPR/Cas9-based screening designed to search for new cellular factors involved in the infection process and host response.06/05/2020
COV20_00067Evaluación de escenarios epidemiológicos de la enfermedad COVID19 mediante un modelo original usando computación de membranas (membrane computing)VHIR-HUVH (INSTITUTO DE INVESTIGACION HOSPITAL UNIVERSITARI VALL D'HEBRON)Fernando BaqueroSe trata de aplicar nuestro conocimiento ya reconocido en el establecimiento de modelos computacionales basados en las nuevas técnicas de membrane computing con el objeto de desarrollar un modelo multiparamétrico y multijerárquico para la predicción del efecto de intervenciones en la epidemia de Co Vid 19. El modelo permite introducir rangos de valores en múltiples niveles (por ejemplo, edades, tasas de contacto, tiempos de contacto, tasas de transmisión, medidas protectoras de la transmisión, efectos de posibles agentes terapéuticos y vacunales -ver mas abajo otros posibles cambios) y observar cómo la modificación de cada uno de los factore o de varios de ellos de forma simultánea influencia la tendencia epidemiológica de la enfermedad. El propósito es ayudar a la toma de decisiones para el establecimiento de intervenciones a la carta para escenarios determinados.08/05/2020
COV20_00115Cuantificación en tiempo real de nuevos casos no reportados de COVID-19 en EspañaCentre de Recerca Matemàtica (CRM)David Moriña SolerEl proyecto propuesto pretende desarrollar un conjunto de modelos matemáticos que permitan cuantificar en tiempo real los nuevos casos no reportados de COVID-19 en España, por comunidades autónomas o por otras zonas de interés. Las estimaciones proporcionadas por estos modelos se usarán para estudiar la dinámica de la enfermedad en base a la aplicación de modelos epidemiológicos compartimentales (tipo SIR, SEIR, SIRS, etc.) que permitirán estimar, de manera más precisa,e la mortalidad y morbilidad asociadas. De manera similar, se usarán estas estimaciones para realizar un análisis exhaustivo del coste-efectividad en diferentes escenarios de actuación realistas, tanto desde el punto de vista de la gestión pública como del social, que podrán ayudar a la toma de decisiones en el ámbito del sistema de salud pública nacional y también dentro de cada comunidad autónoma española, para así hacer frente a la pandemia presente y en futuras situaciones similares.08/05/2020
COV20_00207Estudio de la respuesta inmune en casos anidados en una cohorte para evaluar el efecto de los antiretrovirales en la evolución de la infección por el coronavirus SARS-COV-2.Fundación para la Investigación Biomédica del Hospital Universitario La PazCarolina Cubillos ZapataLos pacientes infectados por el virus CoVid-19 se caracterizan por un alto grado de inflamación y desregulación de la respuesta T especifica. Nosotros en trabajos realizados con pacientes del Hospital Universitario La Paz con enfermedades respiratorias, hemos encontrado que la hipoxia y el estrés oxidativo que sufren estos pacientes hacen que se active el complejo del inflamasoma. Este complejo también tiene efectos en la piroptosis y en la producción de IFN tipo l. Por otra parte, la condición inflamatoria del paciente va a condicionar de manera directa la respuesta T específica. En definitiva, el entendimiento del estado inflamatorio en los pacientes aporta información relevante sobre la evolución de la patología. Este proyecto propone como objeto estudiar el efecto de los medicamentos que se recogen en este ensayo clínico en pacientes con CoVid-19, en la activación del inflamasoma y su efecto en la inflamación y la respuesta T. Estos datos asociados con la evolución del paciente son determinantes para clasificar pacientes respondedores y mecanismos de evasión viral.08/05/2020
COV20_00210Determinación de la presencia de SARS-CoV-2 en muestras ambientales y su potencial transmisión indirecta.Universitat de ValènciaPilar Domingo-CalapAunque el SARS-CoV-2 y otros coronavirus se transmiten fundamentalmente de forma directa entre individuos durante las fases epidémicas, la permanencia del virus en el ambiente tiene el potencial de originar nuevos brotes pese a los esfuerzos de mitigación desplegados. El SARS-CoV-1 se detectó en aguas residuales de hospitales en China y se demostró que las partículas virales podían permanecer infectivas el suficiente tiempo como para constituir un riesgo. Investigaremos el potencial de transmisión ambiental del virus en las condiciones específicas de nuestro país. Para ello nos centraremos primeramente en el análisis de plantas de tratamiento de aguas residuales y en la liberación del virus por vía intestinal. Estudiaremos también la estabilidad del virus, así como su presencia en otros ambientes, como superficies comunes tales como plásticos, acero inoxidable o cristal. Esto proporcionará una valiosa información para el manejo de la epidemia.08/05/2020
COV20_00278ACE2-ORG. Development of a human cellular plaform unveilling Angiotensin-converting enzyme 2 (ACE2) - sars-CoV-2 interactionsInstituto de Bioingeniería de CataluñaNuria MonserratThere are no models allowing to unveil the molecular pathways and cellular responses differently regulated upon SARS-CoV-2 infection in human tissues. Organoid technology represents and affordable solution to COVID-19 research. Our consortia is able to infect a plethora of human organoids opening the door for drug screening for COVID19 treatment. These results are part of a present manuscript under review in Cell. Bases in our current finding our aim is to understand, identify and target ACE2-SARS.CoV2 cellular responses exploiting kidney and heart organoids exposed to systemic conditions worsening COVID19 disease (e.e. Diabetes). Using  scRNA sequentiation we will unveil unique and common cellular responses upon SARS-coV-2 infection and use primary cell cultures and retrospective COVID19 necropsies for validation. This approach will identify top ranked pathwys differentially regulated upong SARS-CoV.2 infection in control and diabetic backgrounds.08/05/2020
COV20_00349Exploiting protective immune responses to COVID-19 to unravel mechanisms associated with favorable clinical outcomes (PROTECTIVE STUDY)FUNDACIÓN PARA LA INVESTIGACIÓN BIOMÉDICA DEL HOSPITAL RAMÓN Y CAJALSergio Serrano-VillarBecause COVID19 spectrum of disease range from asymptomatic disease to severe lung injury leading to death, we aim to exploit extreme clinical phenotypes of COVID-19 disease to identify mechanisms that can be leveraged to improve outcomes and to identify predictors of adverse outcomes. Because the clear correlation between clinical outcomes and age, we plan to recruit individuals across a broad range of age, including pediatric populations, reflecting the broad range of COVID19 disease severity. We will interrogate targeted biological pathways (i.e., ACE2 expression and polymorphisms, antiviral responses and innate and adaptive immunity) and untargeted pathways using plasma metabolomics and enzymolomics. These parameters will be correlated with the clinical phenotype and with virologic measures of CoVID19 using multiparametric data integration through a bioinformatic approach.08/05/2020
COV20_00373SARS-CoV-2 Inhibition, Host Selection and Next-Move Prediction Through High-Performance Computing.Fundació lnstitut de Recerca Biomédica (IRB Barcelo1Modesto OrozcoWe will fight SARS-CoV2 by using massive high-performance computing. Thanks to the recently published X-Ray structures, we will unveil the physico-chemical properties of the viral spike protein, those of the human ACE2 receptor and those of the complex they form to permit virus to infect cells and spread. This information, well implemented with knowledge-based bioinformatics techniques, will help us to understand the mechanism of viral entrance into the cell and what are the "next evolutionary moves" of the CoV family. Unbiased tajectories along with extensive free-energy calculation would help to identify new "druggable spots" (not detectable by crystallography). On this knowledge, we will start a drug discovery effort (of commercially available drugs first) to inhibit the interaction between the virus and the human host, hence impeding virus internalization and spread.08/05/2020
COV20_00416COVID-19, PERFIL INMUNOLÓGICO DE RIESGOVHIR-HUVH (INSTITUTO DE INVESTIGACION HOSPITAL UNIVERSITARI VALL D'HEBRON)Ricardo Pujol Borrell En la actualidad no se sabe si la minoría de casos de COVID-19 que evolucionan mal son debidos a un exceso o un defecto de la respuesta immune innata o de la adaptativa o a una disregulación conjunta. Existen herramientas aun no aplicadas para poder discernir entre los varios escenarios inmunológicos/virológicos en que se desarrolla esta infección. Objetivo: Generar algoritmos/índices para estratificar los enfermos por el perfil de riesgo inmunológico/virológico aplicables al análisis de ensayos clínicos con inmunomodulares en marcha o futuros. Métodos: 1) Captación y análisis diario de parámetros de inflamación, coagulación, inmunología y microbiología además de analítica general en relación con los orígenes de las muestras, de los datos demográficos y evolución clínica; 2) Medición en 120 enfermos del nivel de 16 citocinas y 32 poblaciones linfocitarias para: 3) la generación de algoritmos pronóstico y de orientación terapéutica a partir de 2; 4) Identificación detallada mediante transcriptomica Nanostring® de las vías de respuesta inmune activadas en 40 enfermos y así confirmar/mejorar el algoritmo generado en 3. Módulos de apoyo: 5) colecciones de muestras, 6) extracción de datos clínicos, 7) Análisis bioinformático y bioestadístico y 8) Comunicación/diseminación.08/05/2020
COV20_00437Decoy-ACE2: Uso de ACE2 soluble inactivado catalíticamente como medicamento anti CoVid19Consorcio Centro de Investigación Biomédica en Red M.P. (CIBER) Alberto Marina Moreno y Vicente Rubio ZamoraBuscamos inhibir la entrada celular del coronavirus administrando grandes cantidades de receptor viral (ACE2) soluble (no ligado a células) para que actúe como “decoy”. Inactivaremos por mutagénesis dirigida la actividad carboxipeptidasa de ACE2, sin eliminarle el Zn2+ catalítico con posibles funciones estructurales y sin interferir con la estabilidad de la proteína ni con la interacción de la misma con la espícula viral, y lo produciremos usando baculovirus/células de insecto (sistema que usamos de rutina [2,3]). Purificaremos ACE2 silvestre o mutante por cromatografía de afinidad explotando una etiqueta artificial eliminable. Probaremos que las formas mutantes de ACE2 son catalíticamente inactivas, estables, y que se unen a la región de unión de la proteína viral S. Evaluaremos en cultivos celulares (colaboración con Jesús Rodríguez Díaz, Dept de Microbiología, Hospital Clínico-Universidad de Valencia) la potencia de las formas mutadas para inhibir la infección de inóculos virales. Determinaremos (cristalografía o crioEM) estructuras de complejos mutantes ACE/dominio de unión de S.08/05/2020
COV20_00571Deciphering ACE-2-Mediated SARS-COV-2 Lung InfectionFundación Instituto de Investigación Sanitaria Illes BalearsCarles Barceló PascualDifficulty breathing due to severe pneumonia is by far, the most life-threatening emergency symptom reported for COVID-19. This is because the SARS-CoV-2 virus accesses host cells via the enzyme ACE2, which is most abundant in the alveolar cells of the lungs. We aim to study SARS-CoV-2 receptor ACE2 to identify the regions/residues critical for an efficient cell entry. We also aim to determine how the genetic variants/polymorphisms of main receptor ACE2 found in Spanish population and different tissues impinge on SARS-CoV-2 infection capacity. This have a clear therapeutic applications (e.g. development of ACE2 peptide comprising the critical region as a viral attachment inhibitor and prospective antibody generation) and can be easily transferred to the clinic as it cold explain why different patients have a different susceptibility, symptoms, and outcome of COVID19  depending on the ACE2 polymorphisms. Finaly in an unprecedented analysis of the COVID19 desease in human lung epitheliym, we will make use of CRISPR/Cas9 to study how ACE2-CoV-2 infection affects epithelial organization, cells most susceptible to infection and we will confirm the previous finding in a totally traslational/bench-to-bedside approach.08/05/2020
COV20_00617Predicción dinámica de escenarios de afectación por COVID-19 a corto y medio plazo (PREDICO)Universidade de Santiago de Compostela (USC)Jorge Mira PérezSe trata de predecir la evolución de la expansión e incidencia del COVID-19, solventando los principales problemas con los que se están enfrentando los modelos conocidos: la discutida fiabilidad de los datos disponibles, tanto por dificultades en los mecanismos de detección como por una probable abundancia de infectados asintomáticos. Para ello se plantea un trabajo en tres frentes: a) en base a modelos compartimentales, que proporcionan sistemas de ecuaciones diferenciales; b) con el llamado Modelado Dinámico Empírico, que prescinde de ecuaciones, eliminando así cualquier dependencia en el hecho de predeterminar agentes causales; y c) a través de un análisis de la análisis de la red social española, que realimentará a a) y b). Los trabajos en esos tres bloques tendrán continua interconexión.08/05/2020
COV20_00654COVID-19, perfil inmunológico de riesgo (adscrito al proyecto presentado por el VHIR IP R Pujol-Borrell)Instituto de Investigación Biomédica de Bellvitge (IDIBELL)Jordi Bas MinguetEn la actualidad no se sabe si la minoría de casos de COVID-19 que evolucionan mal son debidos a un exceso o un defecto en la respuesta immune innata o adaptativa o a una disregulación conjunta. Existen herramientas aun no aplicadas para poder discernir entre los varios escenarios inmunológicos en que se desarrolla esta infección. Objetivo: Generar algoritmos para estratificar los enfermos por el perfil de riesgo inmunológico a aplicables al análisis de ensayos clínicos con inmunomodulares en marcha o futuros y, puntualmente apoyar estrategias terapéuticas. Módulos 1) captación y análisis diaria de parámetros de inflamación, coagulación, inmunología y microbiología además de bioquímica en relación con los orígenes de las muestras y los datos demográficos de los pacientes, seguimiento evolutivo y progresiva valoración de los índices más predictivos; 2) Medición en 120 enfermos del nivel de 18 citocinas y 32 poblaciones linfocitarias; 3) Generación algoritmo pronóstico y de orientación terapéutica; 4) Identificación de las vías de respuesta activadas. Módulos de apoyo incluyen generar colecciones de muestras, de extracción de datos clínicos y de análisis estadístico.08/05/2020
COV20_00660Identificación y caracterización de la repuesta inmune T protectora frente a SARS-CoV-2: Guiando con éxito el diseño de vacunasINSTITUTO DE INVESTIGACIÓN DEL SIDA IRSICAIXAJULIA GARCÍA PRADOEn la actualidad desconocemos si la infección por SARS-CoV-2 será capaz de generar memoria inmunológica a nivel poblacional. La presencia de memoria T inmunológica es esencial para el control de un nuevo brote epidémico por CoV-2. Bajo estas premisas, este proyecto propone: 1) Identificar las regiones del CoV-2 reconocidas por la respuesta T inmune asociadas a protección. 2) Determinar el tiempo de generación de estas respuestas. 3) Caracterizar la funcionalidad de las respuestas T asociadas a protección frente al CoV-2. Esta información es esencial para diseñar con éxito y evaluar la inmunogenicidad de un nuevo prototipo de vacuna T en una segunda fase. El objetivo final es alcanzar la protección poblacional prolongada frente al SARS-CoV-2 mediante vacunación.08/05/2020
COV20_00711MIND/COVID-19: Mental health Impact and NeeDs associated with COVID-19: a comprehensive national evaluation in Spain.Fundació Institut del Mar d'investigacions MèdiquesJORDI ALONSO CABALLEROA prospective cohort study of three groups: (1) COVID-19 cases or close contacts recently isolated or quarantined; (2) healthcare workers; and (3) the general population, including both adults and children/adolescents. Recruitment through epidemiologic surveillance services, hospitals, primary care centers in 6 Spanish Autonomous Communities (groups 1 & 2), a panel survey (group 3 - adults), and snowball sampling through social media (group 3 - children/adolescents). Web-based surveys at baseline and 6-month follow-up assess: current living and employment status; COVID-19 infection status; mental health (post-traumatic stress, panic, depression, anxiety, alcohol use, suicidality; services use); psychological functioning; health and quality of life. Specific modules focus on impact of isolation or quarantine (group 1) and care for COVID-19 patients (group 2). Children/adolescents receive adapted modules. Smartphone-based daily brief surveys among groups 1 & 2 will provide additional assessment of main outcomes in the two weeks following baseline assessment.08/05/2020
COV20_00736Estudio de la dinámica de la epidemia de SARS-CoV-2 con modelos epidemiológicos físico-matemáticos. Seguimiento, estrategias de control, simulaciones y prospeccionesUniversidad de MurciaAntonio Guirao PiñeraSe continuará una investigación iniciada sobre la dinámica de crecimiento de la epidemia de SARS-CoV-2 utilizando modelos epidemiológicos físico-matemáticos. El estudio se realizará sobre los datos oficiales del número de enfermos. Se investigarán: las fases de la epidemia (crecimiento exponencial, pico y decrecimiento); la gravedad según la altura y anchura del pico; tasa de crecimiento y número reproductivo; efecto de la incertidumbre en el número de infectados. Se propondrá la base científica para el diseño de las estrategias de contención más idóneas según la optimización de parámetros (no sólo el confinamiento). Se realizarán simulaciones en distintos escenarios de las curvas de incidencia y afectados, que ayuden a anticipar medidas de control, y a entender el riesgo de importación de casos y rebrotes.08/05/2020
COV20_00750Screening radiográfico de inspección de tórax en pacientes con COVID19Agencia Estatal Consejo Superior de Investigaciones Científicas. Francisco Javier Albiol ColomerUno de los aspectos sintomáticos del COVID19 es el efecto de neumonía. Nuestro grupo es experto en análisis de imagen y en su tratamiento para uso combinado con radiólogos. Con los recursos que disponemos queremos ayudar a desarrollar un sistema de screening radiológico basado en inteligencia artificial para ayudar a identificar la severidad de la patología. Durante el proyecto se atenderá a la capacidad de exploración de la solución buscando empresas lideres en el sector como motores y ayuda a la adquisición de imágenes.08/05/2020
COV20_00755Terapias a corto y medio plazo para el tratamiento del COVID-19: senolíticos y desarrollo de vacunasAgencia Estatal Consejo Superior de Investigaciones CientíficasCayetano von KobbeSegún la OMS, la hipertensión, las enfermedades cardiovasculares y crónicas respiratorias, diabetes, inmunodepresión, cáncer, junto con la vejez, pertenecen al grupo de riesgo específico de personas afectadas por la actual pandemia de COVID-19. Según envejecemos, nuestro cuerpo acumula células senescentes, las cuales producen efectos nocivos en el organismo, y se sabe que juegan un papel causal en la aparición de las enfermedades indicadas anteriormente. Este hecho, junto con datos que se van conociendo, colocan a las células senescentes como dianas para eliminar o aliviar los síntomas de la infección. El principal objetivo de este proyecto es la eliminación específica de las células senescentes mediante el uso de senolíticos, para así mejorar el cuadro clínico de los afectados. El hecho de que algunos senolíticos estén ya en fase clínica, significa que su uso en pacientes sería más rápido. El desarrollo de vacunas basada en respuesta celular, también se plantea aquí.08/05/2020
COV20_00788Modelo mecanístico basado en inteligencia artificial para la reutilización de fármacos contra la infección por SARS-CoV-2Fundación Pública Andaluza Progreso y SaludJoaquín Dopazo BlázquezLa rápida expansión del el SARS-CoV-2, un virus nuevo, ha cogido a los sistemas sanitarios sin terapias adecuadas. Aunque el desarrollo de un nuevo fármaco es inviable a corto plazo, la solución de reutilizar fármacos con otras indicaciones acercaría la disponibilidad de nuevas terapias. Las aproximaciones computacionales han demostrado ser más rápidas y baratas que las experimentales. Dentro de estas, las basadas en modelos mecanísticos, que permiten inferir relaciones causa-efecto, han demostrado mayor efectividad que soluciones tradicionales como cribados virtuales u otras. Proponemos el uso de un modelo mecanístico basado en inteligencia artificial que ya ha demostrado su efectividad en enfermedades raras para la reutilización de fármacos para Covid-19.08/05/2020
COV20_00792Utilidad clínica del análisis de la señalización de IL-6 como indicadora de la actividad de la enfermedad COVID-19. Oportunidad terapeútica con bloqueantes del trans-signaling de IL-6Agencia Estatal Consejo Superior de Investigaciones Científicas. Matilde Bustos de Abajo1) Análisis de la respuesta inflamatoria mediante perfil de citoquinas en suero relacionadas con señalización de IL-6 para estratificar pacientes, valorar actividad de la enfermedad COVI-19 y seleccionar pacientes donde atenuar la respuesta inflamatoria mediante el bloqueo de IL-6. 2) Análisis de SNPs de los genes que participan en la señalización de IL-6 que puedan explicar reacciones exacerbadas (datos bioinformáticos y datos a obtener con nuestras muestras). 3) Demostrar la importancia de un bloqueo selectivo de IL-6, es decir bloquear sólo el transsignalling de IL-6 en los pacientes donde exista una respuesta inflamatoria grave con altos niveles de receptor soluble de IL-6. (sIL-6R) y bajos sgp130 (buffer natural del trans-signaling), no afecta la clásica de IL-6. Esto contrasta con el uso de Tociluzimab, donde se inhiben todas las respuestas de IL-6 con afectación de la señalización clásica regeneradora y de defensa de IL-6 en los procesos de inflamación. 08/05/2020
COV20_00932Regulación de la extravasación de macrófagos por agonistas α2 adrenérgicos en el STC asociado a COVID-19Fundación Canaria Instituto de Investigación Sanitaria de Canarias (FIISC)José Federico Díaz GonzálezLos pacientes con COVID-19 grave desarrollan un síndrome de tormenta de citoquinas (STC) que empeora seriamente su pronóstico. El STC se caracteriza por una excesiva acumulación de macrófagos activados que causan una masiva liberación de citoquinas proinflamantorias. Se ha descrito que la depleción de macrófagos en el desarrollo de STC disminuye la letalidad en varios modelos animales. Datos de nuestro laboratorio demuestran que los agonistas de los receptores α2 adrenérgicos previenen la acumulación de los neutrófilos en el foco inflamatorio y resultados preliminares han mostrado un efecto antiinflamatorio similar en los monocitos circulantes. Este proyecto tiene como objetivo principal generar la racionalidad mecanistica que permita apoyar a los agonistas α2 adrenérgicos como moduladores de la migración de los monicitos al foco inflamatorio, con la finalidad de prevenir/tratar a los pacientes de COVID-19 que desarrollen un STC.08/05/2020
COV20_00935Previsión a medio y largo plazo de la propagación del COVID-19Universidad Carlos III de MadridDavid Expóxito SinghEn este proyecto se busca evaluar, mediante simulación de: (1) analizar el efecto de propagación de nuevas epidemias a escala europea así como la eficacia de las políticas de restricción de movimiento de individuos: (2) el impacto de las condiciones climáticas (tanto de verano como de invierno) en la propagación de la epidemia: (3) el efecto de una potencial vacunación selectiva de la población teniendo en cuenta distintos niveles de eficacia de la vacuna así como potenciales mutaciones en el virus que hagan disminuir la inmunidad del colectivo que ya ha sido vacunado o ha sufrido la enfermedad; (4) la eficiencia de distintas medidas de distanciamiento social (cierre de colegios, cierre de trabajo o trabajo remoto para un procentaje de la clase trabajadores, aislamiento social, etc) sobre las siguientes fases de contagios teniendo en cuenta distintos niveles posibles de inmunización colectiva.08/05/2020
COV20_00944REGISTRO OBSERVACIONAL MULTICÉNTRICO DE PACIENTES CON INFECCIÓN POR SARS-COV2 EN UCIP ESPAÑOLAS (SECIP-COVID)FUNDACIÓN PARA LA INVESTIGACIÓN BIOMÉDICA DEL HOSPITAL GREGORIO MARAÑÓNRafael González CortésEstudio prospectivo observacional multicéntrico para caracterizar la infección en pacientes pediatricos críticos por SARS-COV. Se trata de un registro on-line mediante un formulario electrónico en el que participarán UCI pediatricas de toda españa. El registro esta promovido y auspiciado por la Sociedad Española de Cuidados Intensivos Pediátricos. Se registraran variables demográficas, clínicas al ingreso, epidemiológicas, diagnósticas, terapéuticas, microbiológicas y pronósticas.08/05/2020
COV20_00968Niveles de linfocitos T naïve como factor predictivo de la eficacia de la respuesta inmune frente a SARS-CoV-2 y sus potenciales vacunasFundación para la Investigación e Innovación Biosanitaria en Asturias - FINBARebeca Alonso AriasLa capacidad de respuesta inmune eficaz frente a un nuevo patógeno va a depender de manera primordial de la capacidad de renonocimiento específica por parte de los linfocitos T native. La reducción de estas células como consecuencia del envejecimiento fisiológico o secundario a patología podría ser el responsable del inadecuado control de la infección frente al SARS-COV-2. En pacientes con determinado componente genético o fisiopatogénico se puede producir, quizás como mecanismo compensatorio, la respuesta inflamatoria exagerada y descontrolada que unida a otros factores de riesto conduce a un fatal desenlace. Definir el perfil linfocitario que caracteriza a los pacientes con distintos grados de afectación por SARS-CoV-2, permitirá predecir aquellos con mayor riesgo de complicaciones o que podrían no beneficiarse de la vacunación una vez que esta esté disponible.08/05/2020
COV20_00988Impacto de la pandemia de COVID-19 en la salud mental de trabajadores en dispositivos sanitarios. Estudio internacional multicéntrico: The COVID-19 HEROES studyFUNDACIÓN PARA LA INVESTIGACIÓN BIOMÉDICA DEL HOSPITAL UNIVERSITARIO LA PAZMARÍA FE BRAVO ORTIZAunque brotes de enfermedades infecciosas previas como el SRAS han generado problemas de salud mental en las comunidades afectadas, la emergencia sanitaria provocada por el SARS-CoV-2 está alcanzando un impacto sin precedentes, acercando sistemas sanitarios como el español al colapso. Los datos procedentes de China inciden en la importancia y la urgencia de examinar el impacto psicosocial del COVID-19. Esta urgencia es aún mayor en el caso de las personas con mayor nivel de riesgo, entre las que se encuentran los trabajadores de los dispositivos sanitarios. Dada la magnitud de este problema de salud pública y la exposición a la pandemia y sus derivadas que sufren los trabajadores de los dispositivos sanitarios, este estudio de cohorte prospectivo, multicéntrico, de 12 meses de seguimiento, identifica estresores y factores protectores, con el fin de informar políticas sanitarias de manera inmediata.08/05/2020
COV20_01007Interrupción de los procesos virales de transporte a mediados por microtúbulosAGENCIA ESTATAL CSIC CENTRO DE INVESTIGACIONES BIOLÓGICASJOSÉ FERNANDO DIAZ PEREIRAEl SARS-CoV-2 dependen de los microtubulos para su proceso de internalización y liberación, por lo tanto los microtubulos pueden constituir una diana efectiva para detener su replicación. dado que están implicadas en importantes procesos celulares esencial para el crecimiento y la proliferación, esenciales para la replicación vírica. Se disponen de herramientas para visualizar el movimiento de los transportadores microtubulares unidas a péptidos model víricos y de este modo evaluar su respuesta a concentraciones minúsculas de fármacos así como de la mayor biblioteca mundial de fármacos dirigidos contra tubulina. Se realizará un cribaje de la librería en el sistema de evaluación desarrollado buscando fármacos que inhiban este transporte y la replicación viral a dosis tolerables.08/05/2020
COV20_01031Determinación de fenotipos predictores de complicaciones en COVID-19 y evaluación de la eficacia de tratamientos inmunosupresoresFundación Publica Andaluza para la Gestión de la Investigación en Salud de Sevilla (FISEVI) Hospital Universitario Virgen MacarenaJesús Rodríguez BañoEl objetivo del proyecto es (1) Identificar fenotipos predictores de necesidad de ventilación mecánica en la evaluación inicial de los pacientes y su evolución en los primeros días de ingreso, y (2) evaluar la eficacia y seguridad de los tratamientos inmunosupresores utilizados en pacientes sin ventilación mecánica con elevación de marcadores del síndrome de activación macrofágica. Se realizarán mediante estudios de cohortes retrospectivos multicéntricos, con análisis estadísticos avanzados para estudios observacionales.08/05/2020
COV20_01046Seguridad de la lactancia materna (LM) en la infección confirmada por SARS-COV-2 (COVID-19)FUNDACION PARA LA INVESTIGACIÓN BIOMEDICA DEL HOSPITAL UNIVERSITARIO LA PAZAdelina Pellicer MartinezActualmente no existe estudios formales sobre la eficacia de la LM en la transferencia de factores de protección frente a SARS_COV-2, y su seguridad, entendida como la exclusión de la misma como fuente de propagación del virus y causa de enfermedad en el lactante. La LM es fundamental para el correcto desarrollo de las poblaciones neonatales más vulnerables. Este estudio de cohortes evaluará si existe transmisión del virus a través de LM (utilizando tecnología altamente sensible) y si ésta depende de la carga viral. Además, investigará la transferencia de factores inmunológicos/inflamatorios y de marcadores microbiológicos potencialmente asociados a la severidad de Covid-1908/05/2020
COV20_01209Cambios en los test de función pulmonar en pacientes con neumonia por CoVid19FUNDACION HOSPITAL CLINICO UNIVERSITARIO DE VALENCIAJAIME SIGNES-COSTAEl proyecto consiste en un estudio prospectivo, observacional, multicéntrico, que evaluará los cambios en la función pulmonar (espirometría forzada, medida de volúmenes pulmonares estáticos mediante pletismografía y test de difusión pulmonar de monóxido de carbono) que van a presentar los pacientes ingresados con neumonia por CoVid19 según el nivel de gravedad a las 4 y 26 semanas tras el alta hospitalaria. Las alteraciones restrictivas pulmonares se confirmarán mediante pruebas de imagen (TAC tórax alta resolución). La presencia de fenómenos de respuesta inmunitaria que conduzcan a fibrosis pulmonar se van a relacionar con variables demográficas, clínicas y una serie de marcadores biológicos, alguno de ellos ya descrito como co-partícipes en la patogénesis de las enfermedades intersticiales pulmonares, en concreto de la fibrosis pulmonar idiopática.08/05/2020
COV20_01213Modelización matemática y predicción de incidencia de brotes COVID-19 en EuropaUniversidad del País Vasco/Euskal Herriko UnibertsitateaManuel de la SenDesarrollaremos una serie de modelos matemáticos que describan la actual epidemia de coronavirus COVID19, con diversos niveles de sofisticación SIR, SEIR, SSEEIIR, con diversos retardos y estructuras de infecciosidad adaptadas a la literatura médica actualizada según los estudios médicos precisen los parámetros de la situación local. El método de ajuste de los diversos parámetros se realizará mediante regresión lineal (normal equation) y machine learning (gradient descent). Tendremos en cuenta el impacto del distanciamiento social impuesta en diversos estados, así como otras estrategias de control, con el fin de medir su eficacia y determinar las mejores medidas para evitar futuros brotes del COVID en el futuro.08/05/2020
COV20_01304Respuesta Th1/Th2/Th17/Treg y receptores TLRs/KIR en evolución clínica del COVID19Fundación para la Investigación Biomédica del Hospital Universitario Ramón y Cajal (FIBIO)ALEJANDRO VALLEJO TILLERLa respuesta inmune es crucial en los pacientes a partir del 5-7 día de evolución de síntomas. En ese momento, ciertos pacientes desencadenan una respuesta inmune exagerada que agrava su situación clínica (tormenta de citocinas), mientras otros progresan sin causa conocida. El poder analizar la respuesta Th1, Th2, Treg y Th17 en estos pacientes al ingreso podría tener valor predictor de posterior gravedad de la enfermedad. Una activación exacerbada de la respuesta Th1 y baja Th2 podría producir esa tormenta de citocinas descrita. La respuesta Treg y Th17 podría también modular dicha respuesta. En paralelo, el control inicial de la infección por el SARS-CoV-2 también está limitada por la expresión de los receptores Toll like receptors (TLR) expresados en los monocitos y dendríticas (TLR-7 y TLR-8). Asimismo, los receptores KIR de las células NK son importantes para la eliminación de infecciones víricas.08/05/2020
COV20_01333Errores congénitos de la Inmunidad y predisposición a la infección por SARS-Cov-2 y a la gravedad del COVID-19. Acción coordinada internacional. Secuenciación exómica completa. (proyecto 1)FUNDACIÓN INVESTIGACIÓN BIOMÉDICA HOSPITAL LA PAZRebeca Pérez de DiegoLa infección por SARS-Cov-2 es leve o incluso asintomática en muchos pacientes, pero puede causar una enfermedad (COVID-19) grave, principalmente en pacientes mayores de 50 años, especialmente en aquellos con comorbilidades. Hay, sin embargo, pacientes jóvenes sin factores de riesgo con formas graves de la enfermedad. Algunos de estos pacientes podrían tener errores congénitos de la inmunidad (enfermedades a menudo con una penetrancia incompleta). El principal objetivo es la secuenciación del exoma completo, mediante técnicas de secuenciación masiva, en pacientes menores de 50 años del territorio español sin comorbilidades ni factores de riesgo. El proyecto se encuadra en un consorcio internacional, del que somos uno de los grupos participantes (, en el que se compartirá la información para la realización de estudios poblacionales que permitan avanzar hacia una medicina de precisión en pacientes con COVID-19.08/05/2020
COV20_01334Errores congénitos de la Inmunidad y predisposición a la infección por SARS-Cov-2 y a la gravedad del COVID-19. Acción coordinada internacional. Analisis de exomas (proyecto 2)FUNDACION CANARIA INSTITUTO INFESTIGACIÓN SANITARIA DE CANARIAS (FIISC)José Carlos Rodríguez GallegoLa infección por SARS-Cov-2 es leve o incluso asintomática en muchos pacientes, pero puede causar una enfermedad (COVID-19) grave, principalmente en pacientes mayores de 50 años, especialmente en aquellos con comorbilidades. Hay, sin embargo, pacientes jóvenes sin factores de riesgo con formas graves de la enfermedad. Algunos de estos pacientes podrían tener errores congénitos de la inmunidad (enfermedades a menudo con una penetrancia incompleta). El principal objetivo es la secuenciación del exoma completo, mediante técnicas de secuenciación masiva, en pacientes menores de 50 años del territorio español sin comorbilidades ni factores de riesgo. El proyecto se encuadra en un consorcio internacional, del que somos uno de los grupos participantes (, en el que se compartirá la información para la realización de estudios poblacionales que permitan avanzar hacia una medicina de precisión en pacientes con COVID-19.08/05/2020
COV20_00388COVID-19, perfil inmunológico de riesgo (adscrito al proyecto presentado por el VHIR IP R Pujol-Borrell)IGTP (Instituto de Investigación Germans Trias i Pujol)Aina Teniente Serra En la actualidad no se sabe si la minoría de casos de COVID-19 que evolucionan mal son debidos a un exceso o un defecto en la respuesta immune innata o adaptativa o a una disregulación conjunta. Existen herramientas aun no aplicadas para poder discernir entre los varios escenarios inmunológicos en que se desarrolla esta infección. Objetivo: Generar algoritmos para estratificar los enfermos por el perfil de riesgo inmunológico a aplicables al análisis de ensayos clínicos con inmunomodulares en marcha o futuros y, puntualmente apoyar estrategias terapéuticas. Módulos 1) captación y análisis diaria de parámetros de inflamación, coagulación, inmunología y microbiología además de bioquímica en relación con los orígenes de las muestras y los datos demográficos de los pacientes, seguimiento evolutivo y progresiva valoración de los índices más predictivos; 2) Medición en 120 enfermos del nivel de 18 citocinas y 32 poblaciones linfocitarias; 3) Generación algoritmo pronóstico y de orientación terapéutica; 4) Identificación de las vías de respuesta activadas. Módulos de apoyo incluyen generar colecciones de muestras, de extracción de datos clínicos y de análisis estadístico.14/05/2020
COV20_00702Uso de ozono para la reutilización de equipos de protección personal (EPI). Estudio O3CoVid19PPE.Fundación Canaria Instituto de Investigación Sanitaria de Canarias (FIISC)Bernardino Clavo VarasLa lucha que se libra actualmente en España contra el CoVid19 tiene muchos frentes. Uno de los más importantes a nivel estratégico es la escasez de equipos de protección individual (EPI), lo que ha resultado en : 1) un alto porcentaje de profesionales sanitarios contagiados, 2) reducción en el número de profesionales operativos, 3) que los profesionales puedan propagar la infección. El ozono se utiliza desde hace décadas en el tratamiento y desinfección de aguas (residuales y de uso público) y del aire. A bajas concentraciones destruye la mayoría de los virus en pocos minutos. De confirmarse este efecto sobre CoVid19, el ozono podría emplearse para: 1) inactivar el virus en EPI y facilitar su rápida reutilización y disponibilidad para los profesionales, 2) disminuir el número de procedimientos de retirada de EPI como factor de riesgo.14/05/2020
COV20_00749Design and development of peptide inhibitors of SARS CoV2 virus entry for human useAgencia Estatal Consejo Superior de Investigaciones Científicas, M.P.Bruno Sainz AndingHerein we are proposing the use of a low throughput peptide-screening assay to identify peptides that can inhibit SARS-CoV2 virus entry. The rationale is logical, the technology developed to identify these peptides, the feasibility of using peptides inhibitors of viral entry has been tested and proven and the translation of such findings to the clinic (e.g. clinical trials) is practical. Hence, our group is well positioned to tackle the immediate and growing need to develop novel compounds that can treat patients infected with SARS-CoV2. As principal investigator, I have a proven track record in Virology, with a particular emphasis on viral entry and the development and/or identification of compounds that inhibit viral entry. Thus, the proposal outlined below is well within my and my laboratories expertise and capabilities.14/05/2020
COV20_00764Características Estructurales y Dinámicas de Proteínas Intrínsecamente Desordenadas del Virus SARS-CoV-2Agencia Estatal Consejo Superior de Investigaciones CientíficasDouglas Vinson Laurents y Miguel Mompeán GarcíaUna proporción significativa del proteoma SARS-CoV-2 carece de homología con proteínas conocidas y parece no poseer una estructura definida. Las proteínas intrínsecamente desordenadas (IDP) son esenciales para las infecciones virales, ya que secuestran redes reguladoras humanas. Las IDP son refractarias al análisis estructural mediante cristalografía de rayos X o microscopía crioelectrónica. El objetivo de este proyecto es caracterizar la estructura parcial y la dinámica de tres proteínas desordenadas y tres péptidos del proteoma SARS-CoV-2, por ejemplo, el segmento que abarca los residuos 962-1021: FGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMEL TPWQ. Utilizaremos la espectroscopia de RMN y la dinámica molecular, que son los únicos métodos que proporcionan información a nivel atómico sobre las IDPs.14/05/2020
COV20_00856Aplicación de IA a la predicción inmediata de series temporales para optimizar la gestión de recursos en epidemiasUNIVERSIDAD NACIONAL DE EDUCACIÓN A DISTANCIA -- UNEDJosé Luis Aznarte MelladoAnte la incertidumbre generada por la crisis sanitaria, y a partir de la gran cantidad de datos que se generan cada día sobre la enfermedad COVID19, proponemos aplicar las técnicas más modernas y fiables de análisis y predicción de series espaciotemporales mediante /deep-learning/ y otros paradigmas de la inteligencia artificial. El objetivo es desarrollar, de manera inmediata, sistemas predictivos para contagios, ingresos, enfermos en UCI y fallecimientos por provincia y comunidad autónoma, junto a otras magnitudes (logísticas, económicas, ...) que permitan orientar de forma más efectiva la acción del Ministerio de Sanidad en esta y otras crisis. Además, se propone un análisis retrospectivo que permita determinar a posteriori la fecha de inicio de cada foco de la epidemia así como herramientas de visualización y cuadros de mando que permitan extraer conocimiento útil y facilitar la toma de decisiones a partir de los datos.43965
COV20_01054ESTUDIO DE LA CONTAMINACIÓN DE LAS SUPERFÍCIES Y LOS EQUIPOS DE PROTECCIÓN PERSONAL POR PACIENTES CON INFECCIÓN RESPIRATORIA GRAVE POR CORONAVIRUS 2 (SARS-CoV-2) DE PACIENTES SINTOMÁTICOS TRATADOS QUE PRECISEN INGRESO EN EL SERVICIO DE MEDICINA INTENSIVA.IR-HUVH (INSTITUTO DE INVESTIGACION HOSPITAL UNIVERSITARI VALL D'HEBRON)Oriol RocaEl uso de las cánulas nasales de alto flujo (CNAF) en la enfermedad por el SARS-CoV-2 (agente causante de la COVID-19) se podría encontrar limitado por el riesgo de generación de aerosoles que se han asociado con un aumento del riesgo de transmisión de patógenos aéreos. Nuestro objetivo será el de determinar el grado de contaminación de las superficies y equipos de protección personal de los pacientes con enfermedad por el SARS-CoV-2 tratados que precisen ingreso en el Servicio de Medicina Intensiva. Se tomarán frotis de las superficies y del equipo de protección individual (EPI) y se realizará la RT-qPCR para detectar la presencia de SARS-CoV-2. Además, las muestras positivas por RT-qPCR se cultivaran en células Vero E6 para determinar la presencia de virus infeccioso.14/05/2020
COV20_01081Simulación y evaluación de la dinámica de transmisión del virus SARS-CoV-2 en EspañaUNIVERSIDAD NACIONAL DE EDUCACIÓN A DISTANCIA -- UNEDÓscar Gálvez GonzálezEn este proyecto se pretende la construcción de un modelo propio y realista de la sociedad para estudiar la dinámica de transmisión del virus SARS-CoV-2 en España. El modelo está basado en el movimiento aleatorio a través del método de Metropolis Monte Carlos de un número grande de individuos (de 1000.000 a 1.000.000) que interaccionan en determinados escenarios interconectados cuya parametrización trata de describir las diferentes colectividades sociales de las peronas (trabajo, colegio, familia, etc). Se usará un modelo SIR ampliado, para las características de los individuos y por medio de una calibración adecuada con los datos disponibles, se obtendrán los valores del número efectivo de reproducción y tiempo de generación del virus en cada capa social, valorándose la validez de posibles escenarios y medidas del control de la epidemia.14/05/2020
COV20_01265Análisis estructural de las proteinas de membrana del SARS-CoV-2 para el diseño de nuevos inhibidores del ensamblaje viral.Agencia Estatal Consejo Superior de Investigaciones CientíficasMarcial VilarLos coronavirus respiratorios humanos altamente patógenos de la familia SARS (SARS-CoV, MERS y SARS-CoV-2) causan enfermedad letal aguda caracterizada por respuestas inflamatorias exuberantes y daño pulmonar. El paso fundamental de la replicación y diseminación del virus es su ensamblaje completo en la región intermedia entre el ER y el Golgi (ERGIC en inglés), que depende de interacciones proteína-proteína entre las proteínas virales estructurales, principalmente interacciones intramembrana. Sin embargo, la complejidad de este tipo de interacciones y la falta de información estructural ha imposibilitado hasta la fecha entender cómo se ensamblan los virus CoV y poder diseñar herramientas terapéuticas que lo impidan. Con la consecución de este proyecto aportaremos información estructural de estas interacciones a la comunidad científica y farmacéutica como primer paso para lograr su inhibición y el consiguiente ensamblaje viral.14/05/2020
COV20_01275VirionBreak: Cálculo dinámico de la cápside del SARS-CoV-2 para su destrucción por resonanciaUniversidad de A CoruñaFermín Luis Navarrina MartínezEl objetivo del proyecto es realizar un análisis dinámico estructural de la cápside del virus SARS-CoV-2 con el fin de obtener sus frecuencias y modos propios de vibración, y determinar las características de una emisión de radiofrecuencia que pueda provocar su colapso. Estos resultados definirán los parámetros de diseño de un dispositivo emisor (probablemente de microondas en las bandas SHF y EHF del espectro electromagnético) que permita destruir total o parcialmente la cápside del virus por resonancia inducida. En su caso, la construcción de un prototipo y su fabricación posterior podrían realizarse en un plazo breve y con costes bajos. El dispositivo podría ser usado con fines profilácticos de forma inmediata para la desinfección de material inerte y de residuos biológicos contaminados. En caso de que las frecuencias de vibración y la energía necesaria para provocar la destrucción de la cápside resulten inocuas, el mismo principio podría también aplicarse para el tratamiento terapéutico.14/05/2020
COV20_00644Tratamiento de pacientes con COVID-19 y neumonía no grave sin criterios de ingreso hospitalario: ensayo clínico aleatorizado Código de Protocolo: COME-CLEAN EUDRACT 2020-001962-12Hospital Universitario Fundación AlcorcónCarlos Guijarro HerraizObjetivos: evaluar la efectividad de 4 pautas de tratamiento activo en monoterapia (hidroxicloroquina Prednisona, Azitromicina, o Colchicina ) frente a placebo en pacientes con COVID-19 con neumonía no grave sin criterio de ingreso medido como ingreso hospitalario o muerte en las siguientes 2 semanas tras el inicio del tratamiento; evaluar y comparar la seguridad de las pautas de tratamiento a los 28 días y describir los cambios ocurridos en la percepción del estado de salud a las 12 semanas y analizar el impacto de diversos factores clínicos y sociodemográficos en esos potenciales cambios. Diseño: Ensayo clínico aleatorizado, multicéntrico, doble ciego, controlado con placebo. N=1711. Análisis por intención de tratar.21/05/2020
COV20_00644Tratamiento de pacientes con COVID-19 y neumonía no grave sin criterios de ingreso hospitalario: ensayo clínico aleatorizado Código de Protocolo: COME-CLEAN EUDRACT 2020-001962-12Hospital Universitario Fundación AlcorcónCarlos Guijarro HerraizObjetivos: evaluar la efectividad de 4 pautas de tratamiento activo en monoterapia (hidroxicloroquina Prednisona, Azitromicina, o Colchicina ) frente a placebo en pacientes con COVID-19 con neumonía no grave sin criterio de ingreso medido como ingreso hospitalario o muerte en las siguientes 2 semanas tras el inicio del tratamiento; evaluar y comparar la seguridad de las pautas de tratamiento a los 28 días y describir los cambios ocurridos en la percepción del estado de salud a las 12 semanas y analizar el impacto de diversos factores clínicos y sociodemográficos en esos potenciales cambios. Diseño: Ensayo clínico aleatorizado, multicéntrico, doble ciego, controlado con placebo. N=1711. Análisis por intención de tratar.21/05/2020
COV20_01385Estudio del potencial impacto del COVID19 en mascotas y linces.Universidad Complutense de MadridJosé Manuel Sánchez Vizcaino-RodríguezSe ha creado un consorcio con gran experiencia en vigilancia y control sanitario y diseñado un amplio muestreo de animales domésticos (perros, gatos, hurones) y silvestres (linces), algunos con información epidemiológica y clínica y posibilidad de seguimiento, en 5 CCAA que representan el 75% de los casos humanos de COVID19 en España. Las muestras (saliva, suero, hisopos respiratorios y rectales y esponjas especiales para piel) y la encuesta epidemiológica serán recogidas por las red de veterinarios ya establecida. Serán analizadas en VISAVET(BSL3) mediante un ELISA de anticuerpos frente a COVID19, la RT-qPCR, aislamiento, caracterización viral e inmunológica y diagnóstico diferencial. Igualmente se realizarán infecciones experimentales para valorar la infección y difusión viral en gatos. Este proyecto permitirá conocer la presencia o no de animales positivos a COVID19 y su potencial mecanismos de reservorio y liberación viral.18/06/2020